BLASTX nr result
ID: Zingiber25_contig00041567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041567 (491 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319129.1| putative leucine-rich repeat transmembrane p... 55 7e-06 >ref|XP_002319129.1| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222857505|gb|EEE95052.1| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 1106 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -1 Query: 104 GINVEGQYLLELKSKIGDSLNHLDSWDPSDLTSC 3 G+N EGQYLL++KS+IGD+ NHL +W+P+D T C Sbjct: 23 GLNAEGQYLLDIKSRIGDAYNHLSNWNPNDSTPC 56