BLASTX nr result
ID: Zingiber25_contig00041479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041479 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006395120.1| hypothetical protein EUTSA_v10004871mg [Eutr... 60 2e-07 >ref|XP_006395120.1| hypothetical protein EUTSA_v10004871mg [Eutrema salsugineum] gi|557091759|gb|ESQ32406.1| hypothetical protein EUTSA_v10004871mg [Eutrema salsugineum] Length = 227 Score = 60.5 bits (145), Expect = 2e-07 Identities = 44/108 (40%), Positives = 59/108 (54%), Gaps = 12/108 (11%) Frame = +3 Query: 117 DSPLA-----YLELRSRRLEKTLSPPHAFKPKDTPPKESSTIK---ANPRISPLNAGTPN 272 DS LA YL+LRSRRLEK PP +PK P S IK ++ ++ +N+ T Sbjct: 46 DSALAADSSCYLQLRSRRLEK---PPSLAEPKQPPRPHKSGIKESGSSAQVDSVNSNTAA 102 Query: 273 SGREGSFRSRNSEK--GCSSVAEVLCAENNMEPESRE--RETTPCSLI 404 SG RS N + G S AE C EN+++ ESR RE TPC+++ Sbjct: 103 SGSVPVARSCNGDDCFGNSVSAEAFCGENSLDFESRHSTRENTPCNVV 150