BLASTX nr result
ID: Zingiber25_contig00041340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041340 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ14805.1| hypothetical protein PRUPE_ppa002332mg [Prunus pe... 69 5e-10 ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_004233414.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_006344817.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 >gb|EMJ14805.1| hypothetical protein PRUPE_ppa002332mg [Prunus persica] Length = 686 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/70 (52%), Positives = 45/70 (64%) Frame = +3 Query: 42 MTSRLPVWNLPHNVCLRFLDSYIRLGQLDRARDLLDKIPHPHLPSLTILISAFTRRNLPK 221 M S+LP N+P ++ LRFL G L RAR L D+IPHP L + T+LIS TR PK Sbjct: 1 MLSKLPA-NVPSHLSLRFLKICCNSGDLQRARHLFDQIPHPDLRAWTVLISGHTRHGFPK 59 Query: 222 ESIRLYQRLR 251 ESI+LY LR Sbjct: 60 ESIKLYTSLR 69 >ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] gi|297736133|emb|CBI24171.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/70 (47%), Positives = 43/70 (61%) Frame = +3 Query: 42 MTSRLPVWNLPHNVCLRFLDSYIRLGQLDRARDLLDKIPHPHLPSLTILISAFTRRNLPK 221 M S+LP +LP ++ L+F+ Y G L RAR L DKIP P LP+ TILISA T+ Sbjct: 1 MLSKLPT-SLPPHLALKFIKVYSNSGDLQRARHLFDKIPQPDLPTWTILISALTKHGRSL 59 Query: 222 ESIRLYQRLR 251 E+I+ Y R Sbjct: 60 EAIQYYNDFR 69 >ref|XP_004233414.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 685 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/73 (42%), Positives = 45/73 (61%) Frame = +3 Query: 42 MTSRLPVWNLPHNVCLRFLDSYIRLGQLDRARDLLDKIPHPHLPSLTILISAFTRRNLPK 221 M S+LP + L N +FL + G + RAR L D+IPHP + S T+LI+A+T+ PK Sbjct: 1 MLSKLPSFGLTPNS--QFLRALGPSGDIRRARQLFDEIPHPDIRSWTLLITAYTKSGFPK 58 Query: 222 ESIRLYQRLRETK 260 E++ +Y LR K Sbjct: 59 EALEVYDELRARK 71 >ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 741 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/96 (35%), Positives = 47/96 (48%), Gaps = 14/96 (14%) Frame = +3 Query: 6 GYDHSPYLL*GHMTSRLPVW--------------NLPHNVCLRFLDSYIRLGQLDRARDL 143 G+ P+ H T +W N+P ++ LR L + + +G RA+ L Sbjct: 29 GFVLPPFFSITHSTQSSSIWKQLTSTKVAPSVPTNIPSHLGLRLLKAALNVGDFRRAQQL 88 Query: 144 LDKIPHPHLPSLTILISAFTRRNLPKESIRLYQRLR 251 D IP P + + LISAFT R LP E+IRLY LR Sbjct: 89 FDNIPQPDPTTCSTLISAFTTRGLPNEAIRLYASLR 124 >ref|XP_006344817.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum tuberosum] Length = 686 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +3 Query: 117 GQLDRARDLLDKIPHPHLPSLTILISAFTRRNLPKESIRLYQRLRETKDL 266 G + RAR L D+IPHP + S T+LI+A+T+ PKE++ +Y LRE K L Sbjct: 25 GDIRRARQLFDEIPHPDIRSWTLLITAYTKSGFPKEALEVYDELREKKVL 74