BLASTX nr result
ID: Zingiber25_contig00041184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041184 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003559756.1| PREDICTED: uncharacterized protein LOC100841... 58 2e-06 ref|XP_002515302.1| DNA replication regulator dpb11, putative [R... 58 2e-06 >ref|XP_003559756.1| PREDICTED: uncharacterized protein LOC100841278 [Brachypodium distachyon] Length = 1377 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = +1 Query: 136 MHQSRGATSYSSPDKTFSGVRFVLFGFDSVSEAQCRSELVRRGGIDAG 279 MH S Y + F+GVRF L GFDSVSE+Q RSE+ RRGG DAG Sbjct: 1 MHGSDDDVDYGDDARLFAGVRFALVGFDSVSESQYRSEMARRGGADAG 48 >ref|XP_002515302.1| DNA replication regulator dpb11, putative [Ricinus communis] gi|223545782|gb|EEF47286.1| DNA replication regulator dpb11, putative [Ricinus communis] Length = 1069 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 166 SSPDKTFSGVRFVLFGFDSVSEAQCRSELVRRGGIDAGQYDQ 291 +SP KTF GVRFVLFGFD ++ Q R++L+ GG+DAGQY++ Sbjct: 4 ASPSKTFLGVRFVLFGFDPINLRQVRAKLIDGGGVDAGQYNE 45