BLASTX nr result
ID: Zingiber25_contig00041163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041163 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845998.1| hypothetical protein AMTR_s00155p00053970 [A... 60 3e-07 ref|XP_006468318.1| PREDICTED: WPP domain-associated protein-lik... 59 7e-07 ref|XP_006448888.1| hypothetical protein CICLE_v10014183mg [Citr... 59 7e-07 ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 58 1e-06 ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-lik... 58 1e-06 ref|XP_004486461.1| PREDICTED: WPP domain-associated protein-lik... 58 1e-06 ref|XP_002299051.1| myosin heavy chain-related family protein [P... 57 3e-06 ref|XP_006307106.1| hypothetical protein CARUB_v10008693mg [Caps... 55 7e-06 ref|XP_006293684.1| hypothetical protein CARUB_v10022643mg [Caps... 55 7e-06 emb|CBI31022.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-lik... 55 7e-06 ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-lik... 55 1e-05 ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-lik... 55 1e-05 >ref|XP_006845998.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] gi|548848754|gb|ERN07673.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] Length = 907 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYS ILQHYPG+MEILK+IQREL G Sbjct: 868 LEKIYIALDHYSPILQHYPGIMEILKLIQRELKG 901 >ref|XP_006468318.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Citrus sinensis] Length = 936 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYSS+LQHYPG+MEIL++++REL+G Sbjct: 897 LEKIYIALDHYSSVLQHYPGIMEILRLVRRELSG 930 >ref|XP_006448888.1| hypothetical protein CICLE_v10014183mg [Citrus clementina] gi|557551499|gb|ESR62128.1| hypothetical protein CICLE_v10014183mg [Citrus clementina] Length = 926 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYSS+LQHYPG+MEIL++++REL+G Sbjct: 887 LEKIYIALDHYSSVLQHYPGIMEILRLVRRELSG 920 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYS ILQHYPG+ME+LK+++REL+G Sbjct: 864 LEKIYIALDHYSPILQHYPGIMEVLKLVRRELSG 897 >ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-like [Solanum tuberosum] Length = 902 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 9 KIYFVLDHYSSILQHYPGVMEILKMIQRELNGRGS 113 KIY LDHYS +LQHYPG+MEILK+I+REL G + Sbjct: 860 KIYIALDHYSPVLQHYPGIMEILKLIKRELTGEST 894 >ref|XP_004486461.1| PREDICTED: WPP domain-associated protein-like [Cicer arietinum] Length = 857 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 LGKIY LDHYS ILQHYPG++E+L++++REL+G Sbjct: 818 LGKIYVALDHYSPILQHYPGIIEVLELVRRELSG 851 >ref|XP_002299051.1| myosin heavy chain-related family protein [Populus trichocarpa] gi|222846309|gb|EEE83856.1| myosin heavy chain-related family protein [Populus trichocarpa] Length = 848 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYS IL+HYPG+ EILK+I+RELNG Sbjct: 784 LEKIYIALDHYSLILKHYPGITEILKLIRRELNG 817 >ref|XP_006307106.1| hypothetical protein CARUB_v10008693mg [Capsella rubella] gi|482575817|gb|EOA40004.1| hypothetical protein CARUB_v10008693mg [Capsella rubella] Length = 577 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNGR 107 L KIY LDHYS IL+HYPG++EILK+++REL G+ Sbjct: 536 LEKIYIALDHYSPILKHYPGIIEILKLVRRELRGQ 570 >ref|XP_006293684.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|565471766|ref|XP_006293685.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|482562392|gb|EOA26582.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|482562393|gb|EOA26583.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] Length = 829 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYS IL+HYPG++EILK+++REL+G Sbjct: 789 LEKIYIALDHYSPILKHYPGIIEILKLVRRELSG 822 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNGRGS 113 L KIY LDHYS ILQHYPGV+EILK+++REL+ + Sbjct: 768 LEKIYIALDHYSPILQHYPGVIEILKLVRRELSAEST 804 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-like [Vitis vinifera] Length = 902 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNGRGS 113 L KIY LDHYS ILQHYPGV+EILK+++REL+ + Sbjct: 863 LEKIYIALDHYSPILQHYPGVIEILKLVRRELSAEST 899 >ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-like [Glycine max] Length = 854 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYS ILQHYPG++EIL++++REL G Sbjct: 815 LEKIYIALDHYSPILQHYPGIIEILELVRRELTG 848 >ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Glycine max] Length = 854 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 3 LGKIYFVLDHYSSILQHYPGVMEILKMIQRELNG 104 L KIY LDHYS ILQHYPG++EIL++++REL G Sbjct: 815 LEKIYIALDHYSPILQHYPGIIEILELVRRELTG 848