BLASTX nr result
ID: Zingiber25_contig00041066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041066 (300 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein ... 57 2e-06 emb|CBI30704.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002265875.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 628 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/78 (39%), Positives = 46/78 (58%) Frame = -3 Query: 235 GKRHALFCNHLRMVLFVFGLMGSFFLLDSLMLTVIHHFNLHRRGSLQRRRWIVPQNVKSE 56 GK+H F H+R V+F+FGLMG FLLDSLM+++ NL + + + ++ Sbjct: 77 GKKHTWFRKHVRSVVFMFGLMGFLFLLDSLMVSIFDSMNLQGSSAPIKSSGLKDKS---- 132 Query: 55 IPTEERAEKIMYARLLAL 2 P EE++ +MY RLL L Sbjct: 133 YPNEEKSPVLMYDRLLNL 150 >emb|CBI30704.3| unnamed protein product [Vitis vinifera] Length = 629 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/78 (44%), Positives = 48/78 (61%) Frame = -3 Query: 235 GKRHALFCNHLRMVLFVFGLMGSFFLLDSLMLTVIHHFNLHRRGSLQRRRWIVPQNVKSE 56 GK+H F H+R V+F+FGLMG FLLDSLM+++ NL +GS + + KS Sbjct: 77 GKKHTWFRKHVRSVVFMFGLMGFLFLLDSLMVSIFDSMNL--QGSSAPIKSSGLKEDKS- 133 Query: 55 IPTEERAEKIMYARLLAL 2 P EE++ +MY RLL L Sbjct: 134 YPNEEKSPVLMYDRLLNL 151