BLASTX nr result
ID: Zingiber25_contig00040712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00040712 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW61141.1| hypothetical protein ZEAMMB73_943069, partial [Ze... 56 6e-06 >gb|AFW61141.1| hypothetical protein ZEAMMB73_943069, partial [Zea mays] Length = 185 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 6/100 (6%) Frame = -3 Query: 295 SPVVPFLLVAALAMFICREDLRNGYDYVSGVQDKTVLFLVILP------MIGFFAVQSST 134 SPVVP L+VAAL IC+E L Y+ V+ VQ+ V+L ++ + + Sbjct: 20 SPVVPLLVVAALGWVICQETLMGWYEQVTEVQETVADNAVLLVLGAGVLLLALAVAGNRS 79 Query: 133 EKIVIPIAFCTVVFLLRTQLLGPIVVLVLIHLLSKWYCTP 14 E +++P A V+FL++ +L +++LV+++ +Y P Sbjct: 80 EVVLVPAALVLVMFLIQNIVLAALLLLVVVYFAGIYYYRP 119