BLASTX nr result
ID: Zingiber25_contig00040413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00040413 (680 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 92 1e-16 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 83 7e-14 emb|CBI21459.3| unnamed protein product [Vitis vinifera] 64 3e-08 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 92.0 bits (227), Expect = 1e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +1 Query: 1 RTRTVDLLGKTDQTYYYRNDLNCFKDPTCILLHWALPSTDVKIS 132 RTRTVDLLGKT++TYYYRNDLNCFKDPTCILLHWAL STDVKIS Sbjct: 60 RTRTVDLLGKTEKTYYYRNDLNCFKDPTCILLHWALSSTDVKIS 103 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = +1 Query: 1 RTRTVDLLGKTDQTYYYRNDLNCFKDPTCILLHWALPSTDVKIS 132 R RTVDLLGKTDQT YYRND NCFKDPTCI LHWAL ST+VKIS Sbjct: 10 RIRTVDLLGKTDQTDYYRNDSNCFKDPTCIFLHWALSSTNVKIS 53 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 RTRTVDLLGKTDQTYYYRNDLNCFKDPTCI 90 RTRTVDLLGKTDQT YY+NDLNCFKDPTCI Sbjct: 41 RTRTVDLLGKTDQTDYYQNDLNCFKDPTCI 70