BLASTX nr result
ID: Zingiber25_contig00040045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00040045 (505 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY29325.1| Pentatricopeptide repeat-containing protein, puta... 55 1e-05 >gb|EOY29325.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 1112 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/59 (38%), Positives = 36/59 (61%) Frame = +1 Query: 319 LEPDPFHYNLLMKAFSCAGNLHEVLRLFRDMKEAKCDPDIFCYTPVLDALLAASRSEDA 495 L PD YN++MK FS G + E ++L +M E +CDPD+ ++D L A R+++A Sbjct: 502 LAPDSVTYNMMMKCFSKVGQIDEAIKLLSEMLEDQCDPDVIIINSLIDMLFKAGRADEA 560