BLASTX nr result
ID: Zingiber25_contig00039392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00039392 (268 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529628.1| pentatricopeptide repeat-containing protein,... 60 3e-08 ref|XP_004141609.1| PREDICTED: pentatricopeptide repeat-containi... 53 4e-07 >ref|XP_002529628.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530913|gb|EEF32773.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 400 Score = 60.1 bits (144), Expect(2) = 3e-08 Identities = 32/61 (52%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = -2 Query: 180 PRPNEFIYPS-LKSCSDPRLACSLLSKSRFHDFTVVHTALLDSYSRF-SDTNAARCLFDE 7 P+PN FI+P LKSC + ++ S ++K F + VV TAL+DSYSRF SD AR +FDE Sbjct: 106 PKPNHFIFPHVLKSCQNTKVVHSQIAKLGFSQYPVVQTALVDSYSRFMSDIGCARQVFDE 165 Query: 6 M 4 M Sbjct: 166 M 166 Score = 23.1 bits (48), Expect(2) = 3e-08 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 266 SALISAYASRPDPDSPAALRLFAAMLR 186 +AL++AYAS PD +A L+ M+R Sbjct: 77 TALVTAYASNPD-HHLSAFELYRDMVR 102 >ref|XP_004141609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Cucumis sativus] gi|449510706|ref|XP_004163739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Cucumis sativus] Length = 563 Score = 53.1 bits (126), Expect(2) = 4e-07 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 8/66 (12%) Frame = -2 Query: 177 RPNEFIYPS-LKSCSD------PRLACSLLSKSRFHDFTVVHTALLDSYSRF-SDTNAAR 22 RPN FIYP L+SC D ++ + + KS F + VV TA++DSYSRF SD +AR Sbjct: 140 RPNNFIYPHVLRSCPDVLGSNATKMVHTQVLKSGFGGYPVVQTAIVDSYSRFSSDIGSAR 199 Query: 21 CLFDEM 4 +FDEM Sbjct: 200 QMFDEM 205 Score = 26.2 bits (56), Expect(2) = 4e-07 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -3 Query: 266 SALISAYASRPDPDSPAALRLFAAMLR 186 +A+I+AYAS PDP AA L+ M+R Sbjct: 111 TAMITAYASYPDP--KAAFLLYRNMVR 135