BLASTX nr result
ID: Zingiber25_contig00039364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00039364 (671 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE57593.1| hypothetical protein OsJ_07959 [Oryza sativa Japo... 60 6e-07 gb|EEC73799.1| hypothetical protein OsI_08500 [Oryza sativa Indi... 60 6e-07 tpg|DAA36310.1| TPA: putative regulator of chromosome condensati... 59 1e-06 ref|XP_003580391.1| PREDICTED: uncharacterized protein LOC100842... 59 1e-06 ref|XP_003570117.1| PREDICTED: uncharacterized protein LOC100825... 57 4e-06 ref|XP_003570116.1| PREDICTED: uncharacterized protein LOC100825... 57 4e-06 gb|EOY32932.1| Regulator of chromosome condensation (RCC1) famil... 57 5e-06 gb|EOY32931.1| Regulator of chromosome condensation (RCC1) famil... 57 5e-06 gb|EOY32930.1| Regulator of chromosome condensation (RCC1) famil... 57 5e-06 gb|EMT17445.1| Putative E3 ubiquitin-protein ligase HERC2 [Aegil... 57 5e-06 ref|XP_004976599.1| PREDICTED: uncharacterized protein LOC101769... 57 7e-06 ref|XP_004291740.1| PREDICTED: uncharacterized protein LOC101306... 57 7e-06 ref|XP_002313993.2| zinc finger family protein [Populus trichoca... 56 9e-06 >gb|EEE57593.1| hypothetical protein OsJ_07959 [Oryza sativa Japonica Group] Length = 976 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPK 9 M +FE R+P+ R VEQA+ ALKKGAHLLKCG+RGKPK Sbjct: 1 MAGSFEGRSPAARGVEQALVALKKGAHLLKCGKRGKPK 38 >gb|EEC73799.1| hypothetical protein OsI_08500 [Oryza sativa Indica Group] Length = 988 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPK 9 M +FE R+P+ R VEQA+ ALKKGAHLLKCG+RGKPK Sbjct: 1 MAGSFEGRSPAARGVEQALVALKKGAHLLKCGKRGKPK 38 >tpg|DAA36310.1| TPA: putative regulator of chromosome condensation (RCC1) family protein [Zea mays] Length = 1044 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 M +F+ RTP+ R VEQAI ALKKGAHLLKCG+RGKPKF Sbjct: 1 MAGSFDLRTPT-RGVEQAIVALKKGAHLLKCGKRGKPKF 38 >ref|XP_003580391.1| PREDICTED: uncharacterized protein LOC100842512 [Brachypodium distachyon] Length = 1023 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 M +F+ RTP+ R VEQAI ALKKGAHLLKCG+RGKPKF Sbjct: 1 MAGSFDGRTPT-RGVEQAIVALKKGAHLLKCGKRGKPKF 38 >ref|XP_003570117.1| PREDICTED: uncharacterized protein LOC100825305 isoform 2 [Brachypodium distachyon] Length = 940 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 M E R+ + R VEQAI ALKKGAHLLKCG+RGKPKF Sbjct: 1 MAGGLEGRSSATRGVEQAIVALKKGAHLLKCGKRGKPKF 39 >ref|XP_003570116.1| PREDICTED: uncharacterized protein LOC100825305 isoform 1 [Brachypodium distachyon] Length = 1005 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 M E R+ + R VEQAI ALKKGAHLLKCG+RGKPKF Sbjct: 1 MAGGLEGRSSATRGVEQAIVALKKGAHLLKCGKRGKPKF 39 >gb|EOY32932.1| Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain isoform 3 [Theobroma cacao] Length = 883 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 128 DEMGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 D M + R P R++EQAITALKKGA+LLK GRRGKPKF Sbjct: 5 DRMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKF 45 >gb|EOY32931.1| Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain isoform 2 [Theobroma cacao] Length = 929 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 128 DEMGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 D M + R P R++EQAITALKKGA+LLK GRRGKPKF Sbjct: 5 DRMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKF 45 >gb|EOY32930.1| Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain isoform 1 [Theobroma cacao] Length = 1105 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 128 DEMGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 D M + R P R++EQAITALKKGA+LLK GRRGKPKF Sbjct: 5 DRMASDLSRTGPVERDIEQAITALKKGAYLLKYGRRGKPKF 45 >gb|EMT17445.1| Putative E3 ubiquitin-protein ligase HERC2 [Aegilops tauschii] Length = 1003 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 M +F+ R P+ R VEQAI ALKKGAHLLKCG+RGKPKF Sbjct: 1 MAGSFDGRVPT-RGVEQAIVALKKGAHLLKCGKRGKPKF 38 >ref|XP_004976599.1| PREDICTED: uncharacterized protein LOC101769145 [Setaria italica] Length = 1068 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 122 MGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 M +F+ RTP+ R VEQAI ALKKGA+LLKCG+RGKPKF Sbjct: 1 MAGSFDGRTPT-RGVEQAIVALKKGAYLLKCGKRGKPKF 38 >ref|XP_004291740.1| PREDICTED: uncharacterized protein LOC101306203 [Fragaria vesca subsp. vesca] Length = 1109 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 128 DEMGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 D M + R P R++EQA+TALKKGA+LLK GRRGKPKF Sbjct: 5 DRMASDLSRTGPVERDIEQAVTALKKGAYLLKYGRRGKPKF 45 >ref|XP_002313993.2| zinc finger family protein [Populus trichocarpa] gi|550331244|gb|EEE87948.2| zinc finger family protein [Populus trichocarpa] Length = 1104 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 128 DEMGENFERRTPSVREVEQAITALKKGAHLLKCGRRGKPKF 6 D M + R P R++EQAITALKKGA+LLK GRRGKPKF Sbjct: 5 DRMASDLGRTGPVERDIEQAITALKKGAYLLKYGRRGKPKF 45