BLASTX nr result
ID: Zingiber25_contig00039304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00039304 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362492.1| PREDICTED: regulator of nonsense transcripts... 62 6e-08 ref|XP_004244550.1| PREDICTED: regulator of nonsense transcripts... 62 6e-08 ref|XP_006358610.1| PREDICTED: regulator of nonsense transcripts... 59 7e-07 ref|XP_004245855.1| PREDICTED: regulator of nonsense transcripts... 57 3e-06 gb|EPS67765.1| hypothetical protein M569_07005, partial [Genlise... 55 1e-05 >ref|XP_006362492.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum tuberosum] Length = 1264 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 18 NNLYETPSQPDTGGHAYTFLEFNPQDDFVDYMEFQELSQ 134 NNLY+T SQPDTG AYTFLEFN Q + DY EFQELSQ Sbjct: 6 NNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQ 44 >ref|XP_004244550.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum lycopersicum] Length = 1264 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 18 NNLYETPSQPDTGGHAYTFLEFNPQDDFVDYMEFQELSQ 134 NNLY+T SQPDTG AYTFLEFN Q + DY EFQELSQ Sbjct: 6 NNLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFQELSQ 44 >ref|XP_006358610.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum tuberosum] Length = 1267 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 15 ANNLYETPSQPDTGGHAYTFLEFNPQDDFVDYMEFQELSQ 134 +N+LY+T SQPDTG AYTFLEFN Q + DY EF ELSQ Sbjct: 5 SNSLYDTASQPDTGNDAYTFLEFNTQGEEFDYPEFHELSQ 44 >ref|XP_004245855.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum lycopersicum] Length = 1274 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +3 Query: 18 NNLYETPSQPDTGGHAYTFLEFNPQDDFVDYMEFQELSQ 134 N+LY+T SQPDTG YTFLEFN Q + DY EF ELSQ Sbjct: 6 NSLYDTASQPDTGNDVYTFLEFNTQGEEFDYPEFHELSQ 44 >gb|EPS67765.1| hypothetical protein M569_07005, partial [Genlisea aurea] Length = 1245 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +3 Query: 18 NNLYETPSQPDTGGHAYTFLEFNPQ--DDFVDYMEFQELSQ 134 ++LYET SQPDTG AYTF+EFN Q +DF DY EFQELSQ Sbjct: 18 SDLYETLSQPDTGNDAYTFIEFNTQGEEDF-DYPEFQELSQ 57