BLASTX nr result
ID: Zingiber25_contig00038992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038992 (253 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ03027.1| hypothetical protein PRUPE_ppa011328mg [Prunus pe... 57 3e-06 ref|XP_002303019.1| hypothetical protein POPTR_0002s24000g [Popu... 55 1e-05 >gb|EMJ03027.1| hypothetical protein PRUPE_ppa011328mg [Prunus persica] Length = 215 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 106 SAYDVLRSHGLPIGLLPKGVRDFSIDADGRFQAGL 2 S YDVLR+HGLP+GLLPKGV DF +D +GRFQ L Sbjct: 67 SVYDVLRAHGLPMGLLPKGVVDFEVDDEGRFQVHL 101 >ref|XP_002303019.1| hypothetical protein POPTR_0002s24000g [Populus trichocarpa] gi|222844745|gb|EEE82292.1| hypothetical protein POPTR_0002s24000g [Populus trichocarpa] Length = 181 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -1 Query: 106 SAYDVLRSHGLPIGLLPKGVRDFSIDADGRFQAGL 2 S YDVL++HGLPIGLLPKGV++F ID GRF+ L Sbjct: 25 SIYDVLKAHGLPIGLLPKGVKEFKIDETGRFEVHL 59