BLASTX nr result
ID: Zingiber25_contig00038840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038840 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004955391.1| PREDICTED: uncharacterized protein LOC101765... 55 7e-06 >ref|XP_004955391.1| PREDICTED: uncharacterized protein LOC101765324 [Setaria italica] Length = 196 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/56 (53%), Positives = 35/56 (62%), Gaps = 5/56 (8%) Frame = +3 Query: 141 VVLSDGGLHEYPRRVTAGSVL-----GKDAGSFFVCDADEMEIEGLVSAVGAEEEL 293 V+L G L EYPR TA VL D G +F+CDAD M EG V+AVGA+EEL Sbjct: 28 VLLPTGELREYPRPATAARVLEDASASNDGGGWFLCDADRMGFEGPVAAVGADEEL 83