BLASTX nr result
ID: Zingiber25_contig00038649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038649 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003581673.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >ref|XP_003581673.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Brachypodium distachyon] Length = 392 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = +3 Query: 207 NDEFWLDKLDQKDWLAPNAVLKIFRHVRNSESIITAFRKA 326 +D +W+ +LD KDWLAPN VLKIF ++R++ I + FRKA Sbjct: 22 DDSYWMGRLDHKDWLAPNEVLKIFANIRDASLITSVFRKA 61