BLASTX nr result
ID: Zingiber25_contig00038384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038384 (568 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004975096.1| PREDICTED: uncharacterized protein LOC101758... 57 3e-06 ref|XP_002451994.1| hypothetical protein SORBIDRAFT_04g012950 [S... 57 3e-06 >ref|XP_004975096.1| PREDICTED: uncharacterized protein LOC101758026 [Setaria italica] Length = 239 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 344 GNKRKKKLTKQLSMQETTREARWEKRRRQILEKRQRL 454 GN KKKLTKQLSM+ETTRE +WEKRRRQI +R + Sbjct: 51 GNTNKKKLTKQLSMKETTREVKWEKRRRQIQRQRSSM 87 >ref|XP_002451994.1| hypothetical protein SORBIDRAFT_04g012950 [Sorghum bicolor] gi|241931825|gb|EES04970.1| hypothetical protein SORBIDRAFT_04g012950 [Sorghum bicolor] Length = 262 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +2 Query: 236 REAEEGKEAAEFPDERSLMRQPSGAIGDGATDGSEG-GNKRKKKLTKQLSMQETTREARW 412 R+ E+ ++ A+ + M+ P + + G GN R++ L+KQLSM+ETTREA+W Sbjct: 32 RDREKEEDEAQQDEVAEAMKAPLLGWNHNHHEAAGGIGNNRRRLLSKQLSMKETTREAKW 91 Query: 413 EKRRRQILEK 442 EKRRRQIL + Sbjct: 92 EKRRRQILRR 101