BLASTX nr result
ID: Zingiber25_contig00038324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038324 (460 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT05121.1| hypothetical protein F775_30219 [Aegilops tauschii] 59 9e-07 gb|EMS58991.1| hypothetical protein TRIUR3_22195 [Triticum urartu] 58 1e-06 gb|EEC84607.1| hypothetical protein OsI_31437 [Oryza sativa Indi... 57 3e-06 gb|EEE69742.1| hypothetical protein OsJ_29434 [Oryza sativa Japo... 56 4e-06 ref|XP_002462412.1| hypothetical protein SORBIDRAFT_02g025240 [S... 55 7e-06 >gb|EMT05121.1| hypothetical protein F775_30219 [Aegilops tauschii] Length = 78 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/55 (47%), Positives = 40/55 (72%) Frame = +1 Query: 118 PLHHLVVRKLTKLKMVVPGCRTAELQVLLRKTTEYVSYLELKVIVLRKILSLHEA 282 P H+V+R+L +LK +VP R A++ VLLR+T EY+ LELKV LR++ +++ A Sbjct: 24 PFQHMVLRRLRELKKIVPDARDADVDVLLRQTAEYICILELKVAALRRLSAIYGA 78 >gb|EMS58991.1| hypothetical protein TRIUR3_22195 [Triticum urartu] Length = 132 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/56 (46%), Positives = 40/56 (71%) Frame = +1 Query: 118 PLHHLVVRKLTKLKMVVPGCRTAELQVLLRKTTEYVSYLELKVIVLRKILSLHEAA 285 P H+V+R+L +LK +VP R A++ VLLR+T EY+ LELKV LR++ +++ A Sbjct: 32 PFQHMVLRRLRELKKIVPDARDADVDVLLRQTAEYICILELKVAALRRLSAIYGRA 87 >gb|EEC84607.1| hypothetical protein OsI_31437 [Oryza sativa Indica Group] Length = 77 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +1 Query: 118 PLHHLVVRKLTKLKMVVPGCRTAELQVLLRKTTEYVSYLELKVIVLRKILSLHEA 282 PL H+V R+L +LK +VP + VLLR+T EY+ LELKV VLRK+ +++ A Sbjct: 23 PLQHMVQRRLRELKKIVPDAHEDNVDVLLRQTAEYICILELKVAVLRKLAAIYGA 77 >gb|EEE69742.1| hypothetical protein OsJ_29434 [Oryza sativa Japonica Group] Length = 152 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +1 Query: 118 PLHHLVVRKLTKLKMVVPGCRTAELQVLLRKTTEYVSYLELKVIVLRKILSLH 276 PL H+V R+L +LK +VP + VLLR+T EY+ LELKV VLRK+ +++ Sbjct: 23 PLQHMVQRRLRELKKIVPDAHEDNVDVLLRQTAEYICILELKVAVLRKLAAIY 75 >ref|XP_002462412.1| hypothetical protein SORBIDRAFT_02g025240 [Sorghum bicolor] gi|241925789|gb|EER98933.1| hypothetical protein SORBIDRAFT_02g025240 [Sorghum bicolor] Length = 74 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/53 (43%), Positives = 38/53 (71%) Frame = +1 Query: 118 PLHHLVVRKLTKLKMVVPGCRTAELQVLLRKTTEYVSYLELKVIVLRKILSLH 276 P H+ +R+L KLK +VP A++ VLLR+T +Y+ LELK+ VLR++ +++ Sbjct: 20 PFQHMALRRLRKLKKIVPDAHDADVDVLLRQTADYICILELKLTVLRRVSAIY 72