BLASTX nr result
ID: Zingiber25_contig00038249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038249 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17402.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_003631896.1| PREDICTED: probable LRR receptor-like serine... 64 3e-08 gb|EMJ05872.1| hypothetical protein PRUPE_ppa000484mg [Prunus pe... 63 4e-08 ref|XP_004309920.1| PREDICTED: probable LRR receptor-like serine... 62 1e-07 emb|CBI19800.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002280668.1| PREDICTED: probable LRR receptor-like serine... 61 2e-07 ref|XP_006412020.1| hypothetical protein EUTSA_v10024296mg [Eutr... 60 3e-07 ref|XP_006390287.1| hypothetical protein EUTSA_v10018033mg [Eutr... 60 3e-07 ref|XP_006283031.1| hypothetical protein CARUB_v10004023mg [Caps... 60 3e-07 ref|NP_195341.2| putative LRR receptor-like serine/threonine-pro... 60 3e-07 ref|XP_002867031.1| hypothetical protein ARALYDRAFT_491015 [Arab... 60 3e-07 emb|CAA18124.1| putative receptor protein kinase [Arabidopsis th... 60 3e-07 ref|XP_006473902.1| PREDICTED: probable LRR receptor-like serine... 60 4e-07 ref|XP_006435107.1| hypothetical protein CICLE_v10000083mg [Citr... 60 4e-07 dbj|BAJ86449.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 dbj|BAK02926.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 4e-07 ref|XP_002301998.2| leucine-rich repeat family protein [Populus ... 59 5e-07 gb|ESW29936.1| hypothetical protein PHAVU_002G111100g [Phaseolus... 59 7e-07 ref|XP_003581554.1| PREDICTED: probable LRR receptor-like serine... 59 7e-07 ref|XP_002306906.2| hypothetical protein POPTR_0005s25640g [Popu... 59 9e-07 >emb|CBI17402.3| unnamed protein product [Vitis vinifera] Length = 978 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 RS ET EI+ALTAF+L L DPLG L+GWD + SAPCDWR Sbjct: 30 RSAETLAEIEALTAFKLNLHDPLGVLNGWDSSTPSAPCDWR 70 >ref|XP_003631896.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Length = 1130 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 RS ET EI+ALTAF+L L DPLG L+GWD + SAPCDWR Sbjct: 24 RSAETLAEIEALTAFKLNLHDPLGVLNGWDSSTPSAPCDWR 64 >gb|EMJ05872.1| hypothetical protein PRUPE_ppa000484mg [Prunus persica] Length = 1135 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 RS ET EI+ALT+F+L L DPLGAL+GWD + SAPCDWR Sbjct: 24 RSAETVAEIEALTSFKLNLHDPLGALNGWDSTTPSAPCDWR 64 >ref|XP_004309920.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Fragaria vesca subsp. vesca] Length = 1139 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 R + Q EIDALT F+L L+DP+GAL+GWD + SAPCDWR Sbjct: 24 RGPDRQAEIDALTTFKLDLQDPIGALNGWDASTPSAPCDWR 64 >emb|CBI19800.3| unnamed protein product [Vitis vinifera] Length = 898 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 RS + EI ALTAF+L L DPLGALDGW+ + SAPCDWR Sbjct: 23 RSADALSEIKALTAFKLNLHDPLGALDGWNSSTPSAPCDWR 63 >ref|XP_002280668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180 [Vitis vinifera] Length = 1127 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 RS + EI ALTAF+L L DPLGALDGW+ + SAPCDWR Sbjct: 23 RSADALSEIKALTAFKLNLHDPLGALDGWNSSTPSAPCDWR 63 >ref|XP_006412020.1| hypothetical protein EUTSA_v10024296mg [Eutrema salsugineum] gi|557113190|gb|ESQ53473.1| hypothetical protein EUTSA_v10024296mg [Eutrema salsugineum] Length = 1041 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 R+ ++Q EIDALTAF+L L DPLGAL WD + +APCDWR Sbjct: 21 RADDSQPEIDALTAFKLNLHDPLGALSSWDPSTPAAPCDWR 61 >ref|XP_006390287.1| hypothetical protein EUTSA_v10018033mg [Eutrema salsugineum] gi|557086721|gb|ESQ27573.1| hypothetical protein EUTSA_v10018033mg [Eutrema salsugineum] Length = 1134 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 261 EIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 EI ALT+F+L+L DPLGALDGW++ S SAPCDWR Sbjct: 30 EIQALTSFKLSLHDPLGALDGWNQSSPSAPCDWR 63 >ref|XP_006283031.1| hypothetical protein CARUB_v10004023mg [Capsella rubella] gi|482551736|gb|EOA15929.1| hypothetical protein CARUB_v10004023mg [Capsella rubella] Length = 1136 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 249 ETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 E+Q EIDALTAF+L L DPLGAL WD + +APCDWR Sbjct: 24 ESQAEIDALTAFKLNLHDPLGALTSWDPSTPTAPCDWR 61 >ref|NP_195341.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] gi|264664507|sp|C0LGS2.1|Y4361_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At4g36180; Flags: Precursor gi|224589649|gb|ACN59357.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332661228|gb|AEE86628.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 1136 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 249 ETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 E+Q EIDALTAF+L L DPLGAL WD + +APCDWR Sbjct: 24 ESQAEIDALTAFKLNLHDPLGALTSWDPSTPAAPCDWR 61 >ref|XP_002867031.1| hypothetical protein ARALYDRAFT_491015 [Arabidopsis lyrata subsp. lyrata] gi|297312867|gb|EFH43290.1| hypothetical protein ARALYDRAFT_491015 [Arabidopsis lyrata subsp. lyrata] Length = 1132 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 249 ETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 E+Q EIDALTAF+L L DPLGAL WD + +APCDWR Sbjct: 22 ESQAEIDALTAFKLNLHDPLGALTSWDPSTPAAPCDWR 59 >emb|CAA18124.1| putative receptor protein kinase [Arabidopsis thaliana] gi|7270570|emb|CAB81527.1| putative receptor protein kinase [Arabidopsis thaliana] Length = 1134 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 249 ETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 E+Q EIDALTAF+L L DPLGAL WD + +APCDWR Sbjct: 22 ESQAEIDALTAFKLNLHDPLGALTSWDPSTPAAPCDWR 59 >ref|XP_006473902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Citrus sinensis] Length = 1133 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 261 EIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 EI ALT+F+L L+DPLGALDGWD + SAPCDWR Sbjct: 31 EIQALTSFKLHLKDPLGALDGWDSSTPSAPCDWR 64 >ref|XP_006435107.1| hypothetical protein CICLE_v10000083mg [Citrus clementina] gi|557537229|gb|ESR48347.1| hypothetical protein CICLE_v10000083mg [Citrus clementina] Length = 1133 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 261 EIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 EI ALT+F+L L+DPLGALDGWD + SAPCDWR Sbjct: 31 EIQALTSFKLHLKDPLGALDGWDSSTPSAPCDWR 64 >dbj|BAJ86449.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1135 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 R+ E Q EIDAL AFR ALRDP A+ GWD S SAPC WR Sbjct: 9 RAAEVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWR 49 >dbj|BAK02926.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1171 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 R+ E Q EIDAL AFR ALRDP A+ GWD S SAPC WR Sbjct: 45 RAAEVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWR 85 >ref|XP_002301998.2| leucine-rich repeat family protein [Populus trichocarpa] gi|550344158|gb|EEE81271.2| leucine-rich repeat family protein [Populus trichocarpa] Length = 1124 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 261 EIDALTAFRLALRDPLGALDGWDEGSLSAPCDW 359 EI ALT+F+L L DPLGALDGWDE + SAPCDW Sbjct: 30 EIQALTSFKLNLNDPLGALDGWDESTQSAPCDW 62 >gb|ESW29936.1| hypothetical protein PHAVU_002G111100g [Phaseolus vulgaris] Length = 1131 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 RS T EI ALT+F+L L DP+GALDGWD S +APCDWR Sbjct: 20 RSAVTVVEIQALTSFKLNLHDPVGALDGWDPTSPAAPCDWR 60 >ref|XP_003581554.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Brachypodium distachyon] Length = 1161 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = +3 Query: 240 RSRETQGEIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 R+ E Q EIDAL AFR LRDP A+ GWD S SAPC WR Sbjct: 30 RTAEVQAEIDALLAFRAGLRDPYAAMSGWDASSPSAPCSWR 70 >ref|XP_002306906.2| hypothetical protein POPTR_0005s25640g [Populus trichocarpa] gi|550339737|gb|EEE93902.2| hypothetical protein POPTR_0005s25640g [Populus trichocarpa] Length = 1211 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 261 EIDALTAFRLALRDPLGALDGWDEGSLSAPCDWR 362 EI ALT+F+L L DPLGALDGWD + SAPCDWR Sbjct: 114 EIQALTSFKLNLNDPLGALDGWDASTPSAPCDWR 147