BLASTX nr result
ID: Zingiber25_contig00038098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00038098 (283 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002445325.1| hypothetical protein SORBIDRAFT_07g009420 [S... 59 7e-07 gb|AFW61985.1| putative cytochrome P450 superfamily protein [Zea... 55 1e-05 >ref|XP_002445325.1| hypothetical protein SORBIDRAFT_07g009420 [Sorghum bicolor] gi|241941675|gb|EES14820.1| hypothetical protein SORBIDRAFT_07g009420 [Sorghum bicolor] Length = 509 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +3 Query: 3 AAVLWNFEVEVLDAARVEPKNSVMLRMKNGMMVTIKKRT 119 AAVLWNF+VEVL+ + PK S++L+M+NG+MVT+KKRT Sbjct: 471 AAVLWNFDVEVLEGQSIRPKLSILLQMENGLMVTVKKRT 509 >gb|AFW61985.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 524 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 3 AAVLWNFEVEVLDAARVEPKNSVMLRMKNGMMVTIKKR 116 AAV+WNF+VEVL+ V+PK S +L+M+NG+MVT+KKR Sbjct: 481 AAVVWNFDVEVLEGQSVKPKLSFLLQMENGLMVTVKKR 518