BLASTX nr result
ID: Zingiber25_contig00037961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00037961 (562 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY17454.1| Tudor/PWWP/MBT superfamily protein, putative [The... 57 3e-06 ref|XP_006855519.1| hypothetical protein AMTR_s00057p00208300 [A... 57 4e-06 ref|XP_002512413.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >gb|EOY17454.1| Tudor/PWWP/MBT superfamily protein, putative [Theobroma cacao] Length = 1133 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 15/83 (18%) Frame = -2 Query: 411 RVTPPLSS---LRGLPSGAAQPHNYMQHGDVEGRRMGNK------------DLANQMLSL 277 +V PP SS + +P P N + H +V R N D++ QMLSL Sbjct: 1051 KVVPPSSSPSPIHPIPQYGKAPANNLHHTEVAPRNSHNLNTQTIPPGTASIDISQQMLSL 1110 Query: 276 MIRCSDIVSSVKSSLGYVPYHPL 208 + RC+D+V++V LGYVPYHPL Sbjct: 1111 LTRCNDVVTNVTGLLGYVPYHPL 1133 >ref|XP_006855519.1| hypothetical protein AMTR_s00057p00208300 [Amborella trichopoda] gi|548859285|gb|ERN16986.1| hypothetical protein AMTR_s00057p00208300 [Amborella trichopoda] Length = 1283 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 327 EGRRMGNKDLANQMLSLMIRCSDIVSSVKSSLGYVPYHPL 208 E G D++ QML+L++RCSDIVS VK +LGYVPYHPL Sbjct: 1244 ERESRGGVDISRQMLNLLMRCSDIVSDVKCALGYVPYHPL 1283 >ref|XP_002512413.1| conserved hypothetical protein [Ricinus communis] gi|223548374|gb|EEF49865.1| conserved hypothetical protein [Ricinus communis] Length = 1141 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 6/73 (8%) Frame = -2 Query: 408 VTPPLSSLRGLPSGAAQPH-NYMQHGDVEGRRMGNK-----DLANQMLSLMIRCSDIVSS 247 + P S + LP+ A+P N + H + R M N D++ QMLSL+ RC+D+V++ Sbjct: 1069 IPPSPSPILPLPTQFAKPPLNNLHHTEAPIRNMHNLNPPSIDISQQMLSLLTRCNDVVTT 1128 Query: 246 VKSSLGYVPYHPL 208 V LGYVPYHPL Sbjct: 1129 VTGLLGYVPYHPL 1141