BLASTX nr result
ID: Zingiber25_contig00037529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00037529 (546 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580963.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_003580963.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Brachypodium distachyon] Length = 683 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +3 Query: 3 ERGLKKVKGHSWICIRNYIHVFEPNQIFHRKGEAIYSILGLLDWVM 140 ++G KKV+G SW+CI++ IHVF Q+ H GEA Y++L LL W M Sbjct: 611 DQGAKKVQGCSWLCIKSEIHVFTSEQVVHLGGEATYAVLDLLFWEM 656