BLASTX nr result
ID: Zingiber25_contig00036959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00036959 (538 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006662298.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_003571756.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 gb|EMT26433.1| hypothetical protein F775_16328 [Aegilops tauschii] 55 8e-06 ref|XP_002459436.1| hypothetical protein SORBIDRAFT_02g004626 [S... 55 8e-06 >ref|XP_006662298.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Oryza brachyantha] Length = 544 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = -3 Query: 536 HCKARKLDDADMLLKRAVNNGIVPNALTWDIMLNNFISESILTVPEQ 396 HCKAR LDDA MLL RAV GI PN TW IM+ NF +S+ + +Q Sbjct: 494 HCKARLLDDAAMLLNRAVGGGIAPNERTWSIMVQNFARKSLSILADQ 540 >ref|XP_003571756.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Brachypodium distachyon] Length = 673 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -3 Query: 536 HCKARKLDDADMLLKRAVNNGIVPNALTWDIMLNNFISES 417 HCKAR L DA MLL RAV +GI PN TW IM+ NF+ +S Sbjct: 633 HCKARLLHDASMLLNRAVTSGITPNERTWGIMVQNFVRKS 672 >gb|EMT26433.1| hypothetical protein F775_16328 [Aegilops tauschii] Length = 776 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -3 Query: 536 HCKARKLDDADMLLKRAVNNGIVPNALTWDIMLNNFISESI 414 HCKAR LDDA+MLL R+V GI PN TW IM+ NF+ + + Sbjct: 726 HCKARLLDDANMLLNRSVTVGITPNERTWGIMVQNFVRQPL 766 >ref|XP_002459436.1| hypothetical protein SORBIDRAFT_02g004626 [Sorghum bicolor] gi|241922813|gb|EER95957.1| hypothetical protein SORBIDRAFT_02g004626 [Sorghum bicolor] Length = 684 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -3 Query: 536 HCKARKLDDADMLLKRAVNNGIVPNALTWDIMLNNFISESI 414 HCK R LDDA MLL +AV+ GIVPN TW +M+ NF+ + + Sbjct: 641 HCKVRLLDDASMLLDKAVSGGIVPNERTWGMMVQNFVRQPV 681