BLASTX nr result
ID: Zingiber25_contig00036763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00036763 (257 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004970114.1| PREDICTED: uncharacterized protein LOC101766... 68 1e-09 ref|XP_004307069.1| PREDICTED: uncharacterized protein At2g39795... 66 4e-09 gb|EOY22044.1| Mitochondrial glycoprotein family protein, putati... 66 5e-09 ref|XP_002315413.1| hypothetical protein POPTR_0010s25060g [Popu... 66 5e-09 ref|XP_006412450.1| hypothetical protein EUTSA_v10026176mg [Eutr... 65 7e-09 gb|EPS70451.1| hypothetical protein M569_04309 [Genlisea aurea] 65 7e-09 ref|XP_006284921.1| hypothetical protein CARUB_v10006220mg [Caps... 65 7e-09 dbj|BAK07164.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 7e-09 ref|XP_002867234.1| hypothetical protein ARALYDRAFT_328472 [Arab... 65 7e-09 ref|XP_002264200.1| PREDICTED: uncharacterized protein LOC100247... 65 7e-09 gb|AAM65459.1| unknown [Arabidopsis thaliana] 65 7e-09 ref|NP_001078481.1| mitochondrial glycoprotein family protein [A... 65 7e-09 emb|CAA18600.1| putative protein [Arabidopsis thaliana] gi|72701... 65 7e-09 gb|EMJ13146.1| hypothetical protein PRUPE_ppa010810mg [Prunus pe... 65 9e-09 ref|NP_001044382.1| Os01g0771100 [Oryza sativa Japonica Group] g... 65 9e-09 ref|XP_002458571.1| hypothetical protein SORBIDRAFT_03g035870 [S... 65 1e-08 ref|XP_003569918.1| PREDICTED: uncharacterized protein LOC100842... 64 2e-08 ref|XP_002526319.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|NP_001149935.1| mitochondrial glycoprotein [Zea mays] gi|195... 64 3e-08 ref|XP_006350931.1| PREDICTED: mitochondrial acidic protein mam3... 63 3e-08 >ref|XP_004970114.1| PREDICTED: uncharacterized protein LOC101766526 [Setaria italica] Length = 243 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEP 148 +EKLFPFLQAW+YVKDHRNLIRWFK V +FI+E +P Sbjct: 208 NEKLFPFLQAWLYVKDHRNLIRWFKSVATFISEPKP 243 >ref|XP_004307069.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 217 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 252 EKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESE 151 + LFPFLQAW+YVKDHRNL+RWFK VGSF+NE++ Sbjct: 182 DSLFPFLQAWLYVKDHRNLMRWFKSVGSFVNETK 215 >gb|EOY22044.1| Mitochondrial glycoprotein family protein, putative [Theobroma cacao] Length = 230 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESE 151 +E LFPFLQAW+YVKDHRNL+RWFK VG+FINE + Sbjct: 192 NEGLFPFLQAWLYVKDHRNLMRWFKSVGTFINEKK 226 >ref|XP_002315413.1| hypothetical protein POPTR_0010s25060g [Populus trichocarpa] gi|222864453|gb|EEF01584.1| hypothetical protein POPTR_0010s25060g [Populus trichocarpa] Length = 229 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 DEKLF FLQAW+YVK+HR+L+RWFK VG +INE++PA Sbjct: 190 DEKLFNFLQAWLYVKEHRSLMRWFKTVGMYINENKPA 226 >ref|XP_006412450.1| hypothetical protein EUTSA_v10026176mg [Eutrema salsugineum] gi|557113620|gb|ESQ53903.1| hypothetical protein EUTSA_v10026176mg [Eutrema salsugineum] Length = 225 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK VG+F++E+ A Sbjct: 186 NESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENPSA 222 >gb|EPS70451.1| hypothetical protein M569_04309 [Genlisea aurea] Length = 231 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK +G+F+ ES+ A Sbjct: 191 NESLFPFLQAWLYVKDHRNLMRWFKTLGTFVKESDEA 227 >ref|XP_006284921.1| hypothetical protein CARUB_v10006220mg [Capsella rubella] gi|482553626|gb|EOA17819.1| hypothetical protein CARUB_v10006220mg [Capsella rubella] Length = 225 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK VG+F++E+ A Sbjct: 186 NESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENPSA 222 >dbj|BAK07164.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 247 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEP 148 +EKLFPFLQAW+YVKDHRNL+RWFK VG+ ++E +P Sbjct: 211 NEKLFPFLQAWLYVKDHRNLMRWFKSVGAAVSEPKP 246 >ref|XP_002867234.1| hypothetical protein ARALYDRAFT_328472 [Arabidopsis lyrata subsp. lyrata] gi|297313070|gb|EFH43493.1| hypothetical protein ARALYDRAFT_328472 [Arabidopsis lyrata subsp. lyrata] Length = 549 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK VG+F++E+ A Sbjct: 509 NESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENPSA 545 >ref|XP_002264200.1| PREDICTED: uncharacterized protein LOC100247464 [Vitis vinifera] Length = 229 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+ WF+ VG+FINE +P+ Sbjct: 186 NESLFPFLQAWLYVKDHRNLMHWFQRVGTFINEQKPS 222 >gb|AAM65459.1| unknown [Arabidopsis thaliana] Length = 227 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK VG+F++E+ A Sbjct: 187 NESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENPSA 223 >ref|NP_001078481.1| mitochondrial glycoprotein family protein [Arabidopsis thaliana] gi|22136062|gb|AAM91613.1| putative protein [Arabidopsis thaliana] gi|23197726|gb|AAN15390.1| putative protein [Arabidopsis thaliana] gi|222423299|dbj|BAH19625.1| AT4G32605 [Arabidopsis thaliana] gi|332660688|gb|AEE86088.1| mitochondrial glycoprotein family protein [Arabidopsis thaliana] Length = 227 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK VG+F++E+ A Sbjct: 187 NESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENPSA 223 >emb|CAA18600.1| putative protein [Arabidopsis thaliana] gi|7270165|emb|CAB79978.1| putative protein [Arabidopsis thaliana] Length = 557 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LFPFLQAW+YVKDHRNL+RWFK VG+F++E+ A Sbjct: 517 NESLFPFLQAWLYVKDHRNLLRWFKSVGTFVHENPSA 553 >gb|EMJ13146.1| hypothetical protein PRUPE_ppa010810mg [Prunus persica] Length = 235 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -3 Query: 252 EKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 + LFPFL+AW+YVKDHRNL+RWFK VG+FINE++ A Sbjct: 196 DSLFPFLRAWLYVKDHRNLMRWFKSVGTFINENKTA 231 >ref|NP_001044382.1| Os01g0771100 [Oryza sativa Japonica Group] gi|14209581|dbj|BAB56077.1| mitochondrial glycoprotein family protein-like [Oryza sativa Japonica Group] gi|113533913|dbj|BAF06296.1| Os01g0771100 [Oryza sativa Japonica Group] gi|125527867|gb|EAY75981.1| hypothetical protein OsI_03904 [Oryza sativa Indica Group] gi|125572175|gb|EAZ13690.1| hypothetical protein OsJ_03612 [Oryza sativa Japonica Group] gi|215741239|dbj|BAG97734.1| unnamed protein product [Oryza sativa Japonica Group] Length = 243 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINE 157 +EKLFPFLQAW+YVKDHRNLIRWFK VG+ I+E Sbjct: 207 NEKLFPFLQAWLYVKDHRNLIRWFKSVGTLISE 239 >ref|XP_002458571.1| hypothetical protein SORBIDRAFT_03g035870 [Sorghum bicolor] gi|241930546|gb|EES03691.1| hypothetical protein SORBIDRAFT_03g035870 [Sorghum bicolor] Length = 244 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEP 148 +EKLF FLQAW+YVKDHRNLIRWFK VGS I+E +P Sbjct: 208 NEKLFRFLQAWLYVKDHRNLIRWFKSVGSAISEPKP 243 >ref|XP_003569918.1| PREDICTED: uncharacterized protein LOC100842343 isoform 1 [Brachypodium distachyon] gi|357136655|ref|XP_003569919.1| PREDICTED: uncharacterized protein LOC100842343 isoform 2 [Brachypodium distachyon] Length = 245 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINE 157 +EKLFPFLQAW+YVKDHRNL+RWFK VG+ I+E Sbjct: 209 NEKLFPFLQAWLYVKDHRNLVRWFKSVGTVISE 241 >ref|XP_002526319.1| conserved hypothetical protein [Ricinus communis] gi|223534346|gb|EEF36055.1| conserved hypothetical protein [Ricinus communis] Length = 225 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINESEPA 145 +E LF FLQAW+YVKDHRNL+RWFK VG+FINE++ A Sbjct: 186 NEGLFNFLQAWLYVKDHRNLMRWFKTVGTFINENKSA 222 >ref|NP_001149935.1| mitochondrial glycoprotein [Zea mays] gi|195635585|gb|ACG37261.1| mitochondrial glycoprotein [Zea mays] Length = 248 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINE 157 +EKLF FLQAW+YVKDHRNL+RWFK VGSFI++ Sbjct: 205 NEKLFRFLQAWLYVKDHRNLVRWFKSVGSFISD 237 >ref|XP_006350931.1| PREDICTED: mitochondrial acidic protein mam33-like [Solanum tuberosum] Length = 226 Score = 63.2 bits (152), Expect = 3e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 255 DEKLFPFLQAWMYVKDHRNLIRWFKDVGSFINE 157 +E LFPFLQAW+YVKDHRNL+RWFK VGS +N+ Sbjct: 186 NESLFPFLQAWLYVKDHRNLMRWFKTVGSLVND 218