BLASTX nr result
ID: Zingiber25_contig00036333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00036333 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004505557.1| PREDICTED: protein TPX2-like [Cicer arietinum] 57 3e-06 ref|XP_002517880.1| protein with unknown function [Ricinus commu... 55 1e-05 >ref|XP_004505557.1| PREDICTED: protein TPX2-like [Cicer arietinum] Length = 756 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/66 (45%), Positives = 38/66 (57%) Frame = -1 Query: 312 PSPFMPKIREGRSIQIDSLCDFGNVDDEQKADISKEDSHQAEPRTEVDKIARSSKYNLES 133 PSPFMPKI+ GRSI + +LCDF DD K + E+S E +T+ +A SK E Sbjct: 52 PSPFMPKIKAGRSITVGTLCDFSEADDMPKTSANVEESSVLESKTQPQSMA--SKIKEED 109 Query: 132 ETNVGN 115 E N N Sbjct: 110 EDNKEN 115 >ref|XP_002517880.1| protein with unknown function [Ricinus communis] gi|223542862|gb|EEF44398.1| protein with unknown function [Ricinus communis] Length = 702 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 14/102 (13%) Frame = -1 Query: 312 PSPFMPKIREGRSIQIDSLCDFGNVDDEQKADISKED------SHQAEPRTEV------- 172 PSPFMP+I+ GRS +++SLCDF + +Q+ S D S + +P+ E+ Sbjct: 53 PSPFMPRIKTGRSFKVESLCDFSEAEQKQEVTESSSDSPSPSSSSEIKPQVEIMNSTETK 112 Query: 171 DKIARSSKYNLESETNVGNTQNQEVE-KKINSSELDSEVNLC 49 +K + N E+ N+ N QE + + I + E +S+ C Sbjct: 113 EKETTLQEANKENNANLVNVSCQEDKMETIRAEETESKTETC 154