BLASTX nr result
ID: Zingiber25_contig00036323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00036323 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65900.1| hypothetical protein M569_08869, partial [Genlise... 69 7e-10 ref|XP_002263194.2| PREDICTED: uncharacterized protein LOC100250... 69 9e-10 emb|CBI38417.3| unnamed protein product [Vitis vinifera] 69 9e-10 gb|EMJ00976.1| hypothetical protein PRUPE_ppa003711mg [Prunus pe... 67 2e-09 ref|XP_004509431.1| PREDICTED: ubiquilin-like [Cicer arietinum] 66 4e-09 ref|XP_004234514.1| PREDICTED: ubiquilin-2-like [Solanum lycoper... 66 6e-09 ref|XP_006340831.1| PREDICTED: ubiquitin domain-containing prote... 65 7e-09 ref|XP_006340830.1| PREDICTED: ubiquitin domain-containing prote... 65 7e-09 gb|ADW83726.1| ubiquitin 1 [Musa acuminata AAA Group] 65 7e-09 gb|EOX90680.1| Tobamovirus multiplication 1 isoform 2, partial [... 65 9e-09 gb|EOX90679.1| Ubiquitin family protein isoform 1 [Theobroma cacao] 65 9e-09 gb|AEA50963.1| putative PDF1-interacting protein 1, partial [Gos... 65 9e-09 ref|XP_006343334.1| PREDICTED: ubiquitin domain-containing prote... 65 1e-08 ref|XP_006409338.1| hypothetical protein EUTSA_v10022621mg [Eutr... 65 1e-08 ref|XP_006828718.1| hypothetical protein AMTR_s00001p00026840 [A... 65 1e-08 gb|EPS67253.1| hypothetical protein M569_07523, partial [Genlise... 65 1e-08 ref|XP_004985838.1| PREDICTED: ubiquilin-like [Setaria italica] 65 1e-08 ref|XP_004233994.1| PREDICTED: uncharacterized protein LOC101258... 64 2e-08 ref|XP_002465921.1| hypothetical protein SORBIDRAFT_01g048260 [S... 64 2e-08 ref|XP_002328127.1| predicted protein [Populus trichocarpa] 64 2e-08 >gb|EPS65900.1| hypothetical protein M569_08869, partial [Genlisea aurea] Length = 538 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 +++RS+NGSK SV SLE TVG FKVLLA+ D+PAE+ LIYKG+ILKD Sbjct: 19 VNIRSTNGSKFSVNTSLESTVGEFKVLLAQNCDIPAEQQRLIYKGRILKD 68 >ref|XP_002263194.2| PREDICTED: uncharacterized protein LOC100250759 [Vitis vinifera] Length = 483 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T+HVR SNGSK SVQ SLE TV FK +L++ D+PAE+ LIYKG+ILKD Sbjct: 20 TVHVRCSNGSKFSVQISLESTVRAFKAVLSQNCDIPAEQQRLIYKGRILKD 70 >emb|CBI38417.3| unnamed protein product [Vitis vinifera] Length = 127 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T+HVR SNGSK SVQ SLE TV FK +L++ D+PAE+ LIYKG+ILKD Sbjct: 20 TVHVRCSNGSKFSVQISLESTVRAFKAVLSQNCDIPAEQQRLIYKGRILKD 70 >gb|EMJ00976.1| hypothetical protein PRUPE_ppa003711mg [Prunus persica] Length = 555 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 I++R SNGSK SV+ASL+ TVG FK +LA+ D+PAE+ LIYKG+ILKD Sbjct: 20 INIRCSNGSKFSVRASLDSTVGDFKAILAQNCDIPAEQQRLIYKGRILKD 69 >ref|XP_004509431.1| PREDICTED: ubiquilin-like [Cicer arietinum] Length = 539 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 I+VR SNG+K SVQ SL+ TVG FK L+A KSD+P+++ LIYKG+ILKD Sbjct: 23 INVRCSNGTKFSVQVSLDSTVGSFKDLIARKSDIPSQQQRLIYKGRILKD 72 >ref|XP_004234514.1| PREDICTED: ubiquilin-2-like [Solanum lycopersicum] Length = 557 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 TI++R S+GSK SVQ SL+ TVG FK +LA+++++PAE+ LIYKG+ILKD Sbjct: 31 TINIRCSSGSKFSVQVSLDSTVGSFKSILAQQANIPAEQQRLIYKGRILKD 81 >ref|XP_006340831.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X2 [Solanum tuberosum] Length = 551 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 TI+VR SNGSK +VQ +L+ +VG FK LA+ SD+PAE+ LIYKG+ILKD Sbjct: 26 TINVRCSNGSKFTVQVALDSSVGSFKSTLAQHSDIPAEQQRLIYKGRILKD 76 >ref|XP_006340830.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X1 [Solanum tuberosum] Length = 552 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 TI+VR SNGSK +VQ +L+ +VG FK LA+ SD+PAE+ LIYKG+ILKD Sbjct: 26 TINVRCSNGSKFTVQVALDSSVGSFKSTLAQHSDIPAEQQRLIYKGRILKD 76 >gb|ADW83726.1| ubiquitin 1 [Musa acuminata AAA Group] Length = 546 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T+ VR SNGS+ SV+A+L+ TVG K L EK DVPAE+ LIYKG+ILKD Sbjct: 17 TLQVRCSNGSRFSVEAALDSTVGTLKAALVEKCDVPAEQQRLIYKGRILKD 67 >gb|EOX90680.1| Tobamovirus multiplication 1 isoform 2, partial [Theobroma cacao] Length = 479 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T++VR SNGSK SVQ L+ TV FK LLA K D+PA++ LIYKG+ILKD Sbjct: 23 TVNVRCSNGSKFSVQIKLDSTVQSFKALLASKCDIPADQQRLIYKGRILKD 73 >gb|EOX90679.1| Ubiquitin family protein isoform 1 [Theobroma cacao] Length = 559 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T++VR SNGSK SVQ L+ TV FK LLA K D+PA++ LIYKG+ILKD Sbjct: 23 TVNVRCSNGSKFSVQIKLDSTVQSFKALLASKCDIPADQQRLIYKGRILKD 73 >gb|AEA50963.1| putative PDF1-interacting protein 1, partial [Gossypium barbadense] Length = 550 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/50 (58%), Positives = 41/50 (82%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 +++R SNG+K +V+ SLE TVG+FK LLA+ DVPA++ LIYKG++LKD Sbjct: 22 VNIRCSNGTKFTVRTSLESTVGVFKSLLAQNCDVPADQQRLIYKGRVLKD 71 >ref|XP_006343334.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like [Solanum tuberosum] Length = 563 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/51 (58%), Positives = 43/51 (84%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 TI++R S+G+K SVQ SL+ TVG FK +LA+++++PAE+ LIYKG+ILKD Sbjct: 37 TINIRCSSGTKFSVQVSLDSTVGSFKSILAQQANIPAEQQRLIYKGRILKD 87 >ref|XP_006409338.1| hypothetical protein EUTSA_v10022621mg [Eutrema salsugineum] gi|567207571|ref|XP_006409339.1| hypothetical protein EUTSA_v10022621mg [Eutrema salsugineum] gi|557110500|gb|ESQ50791.1| hypothetical protein EUTSA_v10022621mg [Eutrema salsugineum] gi|557110501|gb|ESQ50792.1| hypothetical protein EUTSA_v10022621mg [Eutrema salsugineum] Length = 567 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 ++VR SNGSK SV SL+ TV FK L+AEKSDVPA + LIYKG+ILKD Sbjct: 28 VNVRCSNGSKFSVSTSLDSTVESFKELVAEKSDVPANQQRLIYKGRILKD 77 >ref|XP_006828718.1| hypothetical protein AMTR_s00001p00026840 [Amborella trichopoda] gi|548833697|gb|ERM96134.1| hypothetical protein AMTR_s00001p00026840 [Amborella trichopoda] Length = 578 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 ++H+R SNGSK +VQ L +V FK L+AE SDVPA++ LIYKG+ILKD Sbjct: 19 SVHIRCSNGSKFTVQVDLSSSVSAFKALVAETSDVPAQQQRLIYKGRILKD 69 >gb|EPS67253.1| hypothetical protein M569_07523, partial [Genlisea aurea] Length = 327 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 ++VRS+NGSK SV SL+ TVG FK LLA D+PAE+ LIYKG+ILKD Sbjct: 21 VNVRSTNGSKFSVSTSLQSTVGEFKGLLARNCDIPAEQQRLIYKGRILKD 70 >ref|XP_004985838.1| PREDICTED: ubiquilin-like [Setaria italica] Length = 536 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T+H+R +NGSK +V+A L TVG FK ++AE DVPA + LIYKG+ILKD Sbjct: 20 TLHIRCTNGSKFAVRADLGATVGAFKAIVAESCDVPAPQQRLIYKGRILKD 70 >ref|XP_004233994.1| PREDICTED: uncharacterized protein LOC101258726 [Solanum lycopersicum] Length = 594 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/51 (54%), Positives = 41/51 (80%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 TI++R N S+LSVQ SL+CTVG+FK ++++ +D+PAE +IY G+ILKD Sbjct: 117 TINIRCVNDSELSVQVSLDCTVGLFKFIISQPTDIPAEEQKVIYNGRILKD 167 >ref|XP_002465921.1| hypothetical protein SORBIDRAFT_01g048260 [Sorghum bicolor] gi|241919775|gb|EER92919.1| hypothetical protein SORBIDRAFT_01g048260 [Sorghum bicolor] Length = 538 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 155 TIHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 T+H+R +NGSK +V+A L TVG FK ++AE DVPA + LIYKG+ILKD Sbjct: 20 TLHIRCTNGSKFAVRADLGTTVGAFKAIVAESCDVPAPQQRLIYKGRILKD 70 >ref|XP_002328127.1| predicted protein [Populus trichocarpa] Length = 567 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -3 Query: 152 IHVRSSNGSKLSVQASLECTVGIFKVLLAEKSDVPAERHWLIYKGQILKD 3 I+VR SNG+K +V+ SLE TVG+FK +LA DVPA++ LIYKG+ILKD Sbjct: 28 INVRCSNGTKFTVRTSLESTVGVFKSVLARNCDVPADQQRLIYKGRILKD 77