BLASTX nr result
ID: Zingiber25_contig00036242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00036242 (284 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458175.1| hypothetical protein SORBIDRAFT_03g028240 [S... 56 4e-06 >ref|XP_002458175.1| hypothetical protein SORBIDRAFT_03g028240 [Sorghum bicolor] gi|241930150|gb|EES03295.1| hypothetical protein SORBIDRAFT_03g028240 [Sorghum bicolor] Length = 611 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 284 KTPRFVGRSNIKVLQILNRNVIECYFSTAYGI 189 KTPRFV +SN KVLQIL+RNV +CYFSTAYG+ Sbjct: 580 KTPRFVSQSNSKVLQILSRNVTQCYFSTAYGL 611