BLASTX nr result
ID: Zingiber25_contig00036191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00036191 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 84 3e-14 gb|EPS74526.1| hypothetical protein M569_00243, partial [Genlise... 82 6e-14 dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] 80 3e-13 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 83.6 bits (205), Expect = 3e-14 Identities = 43/50 (86%), Positives = 43/50 (86%) Frame = +1 Query: 10 RLTKARKPGSFRK*IPI*RVHNRMDKLTLTRQFWIQFRIFLGRYREGIGM 159 R TKARK GSFRK IPI RVHNRMDKLTLTRQF I F IFLGRYREGIGM Sbjct: 93 RPTKARKSGSFRKWIPIRRVHNRMDKLTLTRQFGIHFGIFLGRYREGIGM 142 >gb|EPS74526.1| hypothetical protein M569_00243, partial [Genlisea aurea] Length = 66 Score = 82.4 bits (202), Expect = 6e-14 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +1 Query: 10 RLTKARKPGSFRK*IPI*RVHNRMDKLTLTRQFWIQFRIFLGRYREGIGM 159 R TK RKPGSFRK IPI RVHN MDKLTLTRQF I+F IFLGRYREGIGM Sbjct: 16 RPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFGIKFDIFLGRYREGIGM 65 >dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 80.1 bits (196), Expect = 3e-13 Identities = 43/51 (84%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = +1 Query: 10 RLTKARKPGSFRK*IPI*RVHNRMDKLTLTRQF-WIQFRIFLGRYREGIGM 159 R TKARKPGS RK IPI RVHNRMDKLTLTRQF IQF IFLGRYR+GIGM Sbjct: 124 RPTKARKPGSVRKWIPIRRVHNRMDKLTLTRQFGMIQFGIFLGRYRKGIGM 174