BLASTX nr result
ID: Zingiber25_contig00035713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00035713 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844642.1| hypothetical protein AMTR_s00016p00232850 [A... 55 7e-06 >ref|XP_006844642.1| hypothetical protein AMTR_s00016p00232850 [Amborella trichopoda] gi|548847113|gb|ERN06317.1| hypothetical protein AMTR_s00016p00232850 [Amborella trichopoda] Length = 213 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 440 CITNAIHVQRKCPTCRLSLSLSNIHRIYLPGASS 339 CIT+AI Q+KCP CR LS +NIHRIYLPGA+S Sbjct: 180 CITSAIQAQKKCPQCRRKLSNNNIHRIYLPGANS 213