BLASTX nr result
ID: Zingiber25_contig00035591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00035591 (514 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579664.1| PREDICTED: uncharacterized protein LOC100825... 55 1e-05 >ref|XP_003579664.1| PREDICTED: uncharacterized protein LOC100825877 [Brachypodium distachyon] Length = 115 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/90 (37%), Positives = 41/90 (45%), Gaps = 7/90 (7%) Frame = +3 Query: 42 ASTFVAGGEAGGYKEGSHRRMGQQVAPQSSWSVG-SPKCVCAPPTHAGSFKCRLHRAKL- 215 +S+ G A K G AP + G +PKCVCAPPTHAGSFKCRLHR Sbjct: 20 SSSTTPTGAAASPKTKRRGWPGSASAPSGAGGHGPAPKCVCAPPTHAGSFKCRLHRTSSH 79 Query: 216 -----CRVQSAPPLRKATPDQHLPAPDAKN 290 S+PP H AP + + Sbjct: 80 GGGHGSHPSSSPPSPANAAPPHPAAPSSSS 109