BLASTX nr result
ID: Zingiber25_contig00035320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00035320 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159939.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma... 60 4e-07 ref|XP_004143897.1| PREDICTED: BTB/POZ domain-containing protein... 60 4e-07 ref|XP_003631414.1| PREDICTED: BTB/POZ domain-containing protein... 56 4e-06 ref|XP_002304503.2| potassium channel tetramerisation domain-con... 56 6e-06 >ref|XP_004159939.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At5g41330-like [Cucumis sativus] Length = 476 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 295 ERVIKRNMMGGSKVAEGKKINLLGFGGNRMVVARKAEQCVEVWETSAR 152 ERV ++N+MG K G K+ LGFGGN+M V RK EQCVEVW++S + Sbjct: 423 ERVFRKNLMGRMKDLGGGKVMKLGFGGNKMFVIRKDEQCVEVWKSSGK 470 >ref|XP_004143897.1| PREDICTED: BTB/POZ domain-containing protein At5g41330-like [Cucumis sativus] Length = 476 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 295 ERVIKRNMMGGSKVAEGKKINLLGFGGNRMVVARKAEQCVEVWETSAR 152 ERV ++N+MG K G K+ LGFGGN+M V RK EQCVEVW++S + Sbjct: 423 ERVFRKNLMGRMKDLGGGKVMKLGFGGNKMFVIRKDEQCVEVWKSSGK 470 >ref|XP_003631414.1| PREDICTED: BTB/POZ domain-containing protein At5g41330-like [Vitis vinifera] Length = 464 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -1 Query: 295 ERVIKRNMMGGSKVAEGKKINLLGFGGNRMVVARKAEQCVEVWETSAR 152 ERV +RN+MG +K G +I L FGGN+M V RK +Q VEVW++S R Sbjct: 415 ERVYRRNLMGRAKDMGGSRITHLSFGGNKMFVTRKDQQSVEVWQSSVR 462 >ref|XP_002304503.2| potassium channel tetramerisation domain-containing family protein [Populus trichocarpa] gi|550343063|gb|EEE79482.2| potassium channel tetramerisation domain-containing family protein [Populus trichocarpa] Length = 477 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = -1 Query: 295 ERVIKRNMMGGSKVAEGKKINLLGFGGNRMVVARKAEQCVEVWETSAR 152 ERV ++N+MG K EG ++ L FGGN+M V RK Q VEVW++S R Sbjct: 428 ERVFRKNLMGRVKDMEGSRVTNLAFGGNKMFVTRKDRQSVEVWQSSVR 475