BLASTX nr result
ID: Zingiber25_contig00035253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00035253 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002452660.1| hypothetical protein SORBIDRAFT_04g030120 [S... 64 2e-08 dbj|BAD45365.1| hypothetical protein [Oryza sativa Japonica Group] 63 3e-08 ref|XP_004965360.1| PREDICTED: uncharacterized protein LOC101757... 63 5e-08 gb|AFW77064.1| hypothetical protein ZEAMMB73_160663 [Zea mays] 63 5e-08 gb|ACG29454.1| hypothetical protein [Zea mays] 63 5e-08 ref|NP_001142952.1| uncharacterized protein LOC100275400 [Zea ma... 63 5e-08 ref|NP_001047903.1| Os02g0711400 [Oryza sativa Japonica Group] g... 62 6e-08 ref|XP_002452661.1| hypothetical protein SORBIDRAFT_04g030130 [S... 62 8e-08 gb|AFW73077.1| hypothetical protein ZEAMMB73_846073 [Zea mays] 62 1e-07 ref|XP_002436978.1| hypothetical protein SORBIDRAFT_10g013040 [S... 61 1e-07 ref|XP_004953664.1| PREDICTED: uncharacterized protein LOC101773... 61 2e-07 ref|XP_004953665.1| PREDICTED: uncharacterized protein LOC101773... 60 4e-07 gb|EAZ24367.1| hypothetical protein OsJ_08120 [Oryza sativa Japo... 59 9e-07 ref|NP_175330.1| uncharacterized protein [Arabidopsis thaliana] ... 58 1e-06 dbj|BAK03936.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 ref|XP_003570221.1| PREDICTED: uncharacterized protein LOC100831... 57 2e-06 ref|XP_006393321.1| hypothetical protein EUTSA_v10011830mg [Eutr... 55 7e-06 >ref|XP_002452660.1| hypothetical protein SORBIDRAFT_04g030120 [Sorghum bicolor] gi|241932491|gb|EES05636.1| hypothetical protein SORBIDRAFT_04g030120 [Sorghum bicolor] Length = 150 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSGVIYYD DGRRL++ P PRSP+RSPLP+ Sbjct: 105 QPLDFSGVIYYDADGRRLAQAPPPRSPLRSPLPA 138 >dbj|BAD45365.1| hypothetical protein [Oryza sativa Japonica Group] Length = 171 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLP 99 QPLDFSGVIYYD DGRRL+ P PRSPMRSPLP Sbjct: 126 QPLDFSGVIYYDADGRRLAHPPPPRSPMRSPLP 158 >ref|XP_004965360.1| PREDICTED: uncharacterized protein LOC101757962 [Setaria italica] Length = 119 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSGVIYYD +GRRL++ P PRSPMRSPLP+ Sbjct: 75 QPLDFSGVIYYDAEGRRLAQPPPPRSPMRSPLPA 108 >gb|AFW77064.1| hypothetical protein ZEAMMB73_160663 [Zea mays] Length = 127 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSGVIYYD +GRRL++ P PRSPMRSPLP+ Sbjct: 82 QPLDFSGVIYYDAEGRRLAQPPPPRSPMRSPLPA 115 >gb|ACG29454.1| hypothetical protein [Zea mays] Length = 51 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSGVIYYD +GRRL++ P PRSPMRSPLP+ Sbjct: 6 QPLDFSGVIYYDAEGRRLAQPPPPRSPMRSPLPA 39 >ref|NP_001142952.1| uncharacterized protein LOC100275400 [Zea mays] gi|195611950|gb|ACG27805.1| hypothetical protein [Zea mays] gi|195617598|gb|ACG30629.1| hypothetical protein [Zea mays] Length = 141 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPSFATRSPVTAAY 135 QPLDFSGVIYYD GRRL++ P PRSP+RSPLP+ + + AAY Sbjct: 98 QPLDFSGVIYYDAQGRRLAQAPPPRSPLRSPLPA-SVKLAANAAY 141 >ref|NP_001047903.1| Os02g0711400 [Oryza sativa Japonica Group] gi|41052652|dbj|BAD07500.1| unknown protein [Oryza sativa Japonica Group] gi|113537434|dbj|BAF09817.1| Os02g0711400 [Oryza sativa Japonica Group] gi|125540867|gb|EAY87262.1| hypothetical protein OsI_08663 [Oryza sativa Indica Group] Length = 138 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSGVIYYD +GRRL + P PRSP+RSPLPS Sbjct: 91 QPLDFSGVIYYDAEGRRLEQPPPPRSPLRSPLPS 124 >ref|XP_002452661.1| hypothetical protein SORBIDRAFT_04g030130 [Sorghum bicolor] gi|241932492|gb|EES05637.1| hypothetical protein SORBIDRAFT_04g030130 [Sorghum bicolor] Length = 138 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSG IYYD +GRRL + PTPRSP+RSPLP+ Sbjct: 94 QPLDFSGAIYYDAEGRRLEQPPTPRSPLRSPLPA 127 >gb|AFW73077.1| hypothetical protein ZEAMMB73_846073 [Zea mays] Length = 132 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPL+FSG IYYD +GRRL + PTPRSP+RSPLPS Sbjct: 88 QPLEFSGAIYYDAEGRRLEQPPTPRSPLRSPLPS 121 >ref|XP_002436978.1| hypothetical protein SORBIDRAFT_10g013040 [Sorghum bicolor] gi|241915201|gb|EER88345.1| hypothetical protein SORBIDRAFT_10g013040 [Sorghum bicolor] Length = 121 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSG IYYD +GRRL++ P PRSPMRSPLP+ Sbjct: 76 QPLDFSGAIYYDAEGRRLAQPPPPRSPMRSPLPA 109 >ref|XP_004953664.1| PREDICTED: uncharacterized protein LOC101773289 [Setaria italica] Length = 166 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPSFA 108 QPLDFSG I+YD +GRRL + PTPRSP+RSPLP+ A Sbjct: 121 QPLDFSGAIHYDAEGRRLEQPPTPRSPLRSPLPASA 156 >ref|XP_004953665.1| PREDICTED: uncharacterized protein LOC101773700 [Setaria italica] Length = 139 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLDFSGVIYYD +G RL++ P PRSP+RSPLP+ Sbjct: 95 QPLDFSGVIYYDAEGHRLAQPPPPRSPLRSPLPA 128 >gb|EAZ24367.1| hypothetical protein OsJ_08120 [Oryza sativa Japonica Group] Length = 138 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPLD SGVIYY+ +GRRL + P PRSP+RSPLPS Sbjct: 91 QPLDLSGVIYYEAEGRRLEQPPPPRSPLRSPLPS 124 >ref|NP_175330.1| uncharacterized protein [Arabidopsis thaliana] gi|7770334|gb|AAF69704.1|AC016041_9 F27J15.21 [Arabidopsis thaliana] gi|45476547|gb|AAS65939.1| At1g49000 [Arabidopsis thaliana] gi|46359837|gb|AAS88782.1| At1g49000 [Arabidopsis thaliana] gi|332194258|gb|AEE32379.1| uncharacterized protein AT1G49000 [Arabidopsis thaliana] Length = 156 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPSFATRS 117 +PLDFSGVIYYD +GR L+EVP PRSP +PLPS+ TRS Sbjct: 119 EPLDFSGVIYYDSNGRLLNEVP-PRSPRGTPLPSYPTRS 156 >dbj|BAK03936.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 140 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPL+FSG IYYD +GRRL PTPR+P+RSPLP+ Sbjct: 99 QPLEFSGAIYYDAEGRRLGAPPTPRTPVRSPLPA 132 >ref|XP_003570221.1| PREDICTED: uncharacterized protein LOC100831436 [Brachypodium distachyon] Length = 140 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPS 102 QPL+FSG IYYD +GRRL P PR+PMRSPLP+ Sbjct: 99 QPLEFSGAIYYDAEGRRLGAPPPPRTPMRSPLPA 132 >ref|XP_006393321.1| hypothetical protein EUTSA_v10011830mg [Eutrema salsugineum] gi|557089899|gb|ESQ30607.1| hypothetical protein EUTSA_v10011830mg [Eutrema salsugineum] Length = 167 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 1 QPLDFSGVIYYDVDGRRLSEVPTPRSPMRSPLPSFATRS 117 +PLDFSG IYYD +GR+L EVP PRSP +PLP + TRS Sbjct: 130 EPLDFSGAIYYDCNGRQLKEVP-PRSPRGTPLPIYPTRS 167