BLASTX nr result
ID: Zingiber25_contig00034155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00034155 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580688.1| PREDICTED: uncharacterized protein LOC100833... 60 2e-07 gb|EMT01987.1| hypothetical protein F775_33299 [Aegilops tauschii] 58 1e-06 >ref|XP_003580688.1| PREDICTED: uncharacterized protein LOC100833033 [Brachypodium distachyon] Length = 316 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/65 (52%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Frame = -3 Query: 372 HDYDREVERVSSGEFLCPENLV--GGTPRLGHFVIRAGTPTDGFCHNNKTSRMSWQPPAA 199 HD++ EVE+V S EFLC EN V GTP LGHF+IRAG P D FC S Q AA Sbjct: 255 HDFNFEVEQVLSKEFLCDENRVQGSGTPSLGHFLIRAGGPKDSFC--------SGQDSAA 306 Query: 198 GTTAG 184 ++G Sbjct: 307 AASSG 311 >gb|EMT01987.1| hypothetical protein F775_33299 [Aegilops tauschii] Length = 88 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = -3 Query: 372 HDYDREVERVSSGEFLCPENLVGG--TPRLGHFVIRAGTPTDGFCHNNKTSR 223 HD++ EVE+V S EFLC EN V G TP L H+VIR G P D FC + SR Sbjct: 27 HDFNFEVEQVLSKEFLCDENRVAGSGTPSLAHYVIRPGGPADAFCAAGQDSR 78