BLASTX nr result
ID: Zingiber25_contig00034116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00034116 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||1615137B chlorophyll a/b binding protein P27 67 2e-09 gb|AFV34723.1| light harvesting chlorophyll a/b-binding protein ... 67 2e-09 gb|AEW70716.1| light harvesting chlorophyll a-b binding protein ... 67 2e-09 gb|ABO10493.1| light-harvesting chlorophyll a/b binding protein ... 67 2e-09 gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyl... 67 2e-09 gb|ABQ02464.1| chloroplast chlorophyll a/b binding protein [Phyl... 67 3e-09 sp|P24006.1|CB2A_PYRPY RecName: Full=Chlorophyll a-b binding pro... 66 4e-09 sp|P06671.1|CB22_MAIZE RecName: Full=Chlorophyll a-b binding pro... 66 4e-09 gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein ... 66 4e-09 ref|XP_004489391.1| PREDICTED: chlorophyll a-b binding protein 3... 66 4e-09 gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus pe... 66 4e-09 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus pe... 66 4e-09 gb|AAB19041.1| type 1 light-harvesting chlorophyll a/b-binding p... 66 4e-09 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein... 66 4e-09 sp|P15194.1|CB2B_PINSY RecName: Full=Chlorophyll a-b binding pro... 66 4e-09 sp|P15193.1|CB2A_PINSY RecName: Full=Chlorophyll a-b binding pro... 66 4e-09 tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea m... 66 4e-09 gb|ACN40194.1| unknown [Picea sitchensis] 66 4e-09 ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays]... 66 4e-09 gb|ACF84273.1| unknown [Zea mays] gi|195619060|gb|ACG31360.1| ch... 66 4e-09 >prf||1615137B chlorophyll a/b binding protein P27 Length = 233 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DHIADPVNNNAWAYATNFVPGK Sbjct: 204 KGPIENLADHIADPVNNNAWAYATNFVPGK 233 >gb|AFV34723.1| light harvesting chlorophyll a/b-binding protein 2-1 [Dendrocalamus latiflorus] Length = 263 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 234 KGPIENLFDHVADPVNNNAWAYATNFVPGK 263 >gb|AEW70716.1| light harvesting chlorophyll a-b binding protein 2-1 [Phyllostachys edulis] Length = 263 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 234 KGPIENLFDHVADPVNNNAWAYATNFVPGK 263 >gb|ABO10493.1| light-harvesting chlorophyll a/b binding protein [Bambusa oldhamii] Length = 263 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 234 KGPIENLFDHVADPVNNNAWAYATNFVPGK 263 >gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis] Length = 263 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 234 KGPIENLFDHVADPVNNNAWAYATNFVPGK 263 >gb|ABQ02464.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis] Length = 263 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 234 KGPIENLADHVADPVNNNAWAYATNFVPGK 263 >sp|P24006.1|CB2A_PYRPY RecName: Full=Chlorophyll a-b binding protein 1A, chloroplastic; AltName: Full=LHCII type II CAB-1A; Short=LHCP; Flags: Precursor gi|218019|dbj|BAA00449.1| light harvesting a/b binding protein [Pyrus pyrifolia var. culta] Length = 278 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 249 KGPIENLADHLADPVNNNAWAYATNFVPGK 278 >sp|P06671.1|CB22_MAIZE RecName: Full=Chlorophyll a-b binding protein, chloroplastic; AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor gi|22357|emb|CAA68451.1| LHCP [Zea mays] Length = 265 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGP+ENL DHIADPVNNNAWAYATNFVPGK Sbjct: 236 KGPLENLADHIADPVNNNAWAYATNFVPGK 265 >gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein 1-1 [Dendrocalamus latiflorus] Length = 265 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 236 KGPIENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_004489391.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cicer arietinum] Length = 268 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL+DHIADPVNNNAWA+ATNFVPGK Sbjct: 239 KGPIENLVDHIADPVNNNAWAFATNFVPGK 268 >gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica] Length = 265 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 236 KGPIENLADHLADPVNNNAWAYATNFVPGK 265 >gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica] Length = 267 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 238 KGPIENLADHLADPVNNNAWAYATNFVPGK 267 >gb|AAB19041.1| type 1 light-harvesting chlorophyll a/b-binding polypeptide, partial [Pinus palustris] Length = 95 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 66 KGPIENLADHLADPVNNNAWAYATNFVPGK 95 >dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGP+ENL+DH+ADPVNNNAWAYATNFVPGK Sbjct: 238 KGPLENLVDHLADPVNNNAWAYATNFVPGK 267 >sp|P15194.1|CB2B_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1B, chloroplastic; AltName: Full=Chlorophyll a-b binding protein type II 1B; Short=CAB; AltName: Full=LHCP; Flags: Precursor gi|20665|emb|CAA32658.1| unnamed protein product [Pinus sylvestris] Length = 274 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 245 KGPIENLADHLADPVNNNAWAYATNFVPGK 274 >sp|P15193.1|CB2A_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1A, chloroplastic; AltName: Full=Chlorophyll a-b binding protein type II 1A; Short=CAB; AltName: Full=LHCP; Flags: Precursor gi|20661|emb|CAA32657.1| unnamed protein product [Pinus sylvestris] Length = 278 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 249 KGPIENLADHLADPVNNNAWAYATNFVPGK 278 >tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea mays] Length = 259 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGP+ENL DHIADPVNNNAWAYATNFVPGK Sbjct: 230 KGPLENLADHIADPVNNNAWAYATNFVPGK 259 >gb|ACN40194.1| unknown [Picea sitchensis] Length = 274 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGPIENL DH+ADPVNNNAWAYATNFVPGK Sbjct: 245 KGPIENLADHLADPVNNNAWAYATNFVPGK 274 >ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays] gi|195619284|gb|ACG31472.1| chlorophyll a-b binding protein 2 [Zea mays] gi|414881723|tpg|DAA58854.1| TPA: chlorophyll a-b binding protein 2 [Zea mays] Length = 264 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGP+ENL DHIADPVNNNAWAYATNFVPGK Sbjct: 235 KGPLENLADHIADPVNNNAWAYATNFVPGK 264 >gb|ACF84273.1| unknown [Zea mays] gi|195619060|gb|ACG31360.1| chlorophyll a-b binding protein 2 [Zea mays] Length = 266 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 337 KGPIENLLDHIADPVNNNAWAYATNFVPGK 248 KGP+ENL DHIADPVNNNAWAYATNFVPGK Sbjct: 237 KGPLENLADHIADPVNNNAWAYATNFVPGK 266