BLASTX nr result
ID: Zingiber25_contig00033429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00033429 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531296.1| Light-inducible protein CPRF-2, putative [Ri... 55 7e-06 >ref|XP_002531296.1| Light-inducible protein CPRF-2, putative [Ricinus communis] gi|223529129|gb|EEF31109.1| Light-inducible protein CPRF-2, putative [Ricinus communis] Length = 453 Score = 55.5 bits (132), Expect = 7e-06 Identities = 41/106 (38%), Positives = 50/106 (47%), Gaps = 14/106 (13%) Frame = -2 Query: 315 AARPPYDQPAADGSVDYQAFLKQKLDMFCAAVAMSRGSVVNXXXXXXXXXXXXXXXXATL 136 AA PP + PA S DYQAFLK KL++ CAAVA SR S + + Sbjct: 118 AAAPPPNIPA--DSEDYQAFLKSKLNLACAAVAQSRASFLKPEDSSARADSGLQASNTSQ 175 Query: 135 IGSQATVKGTDHG-------------GVPAL-STMQNSVVQAKPAT 40 +GS A KG H G+P+L ST + SVV KP T Sbjct: 176 LGSHAPSKGAGHDVFRSQEVDVDGSVGIPSLPSTHKKSVVPLKPTT 221