BLASTX nr result
ID: Zingiber25_contig00033154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00033154 (646 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003578269.1| PREDICTED: UPF0481 protein At3g47200-like is... 57 5e-06 >ref|XP_003578269.1| PREDICTED: UPF0481 protein At3g47200-like isoform 1 [Brachypodium distachyon] gi|357158880|ref|XP_003578270.1| PREDICTED: UPF0481 protein At3g47200-like isoform 2 [Brachypodium distachyon] Length = 368 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/96 (31%), Positives = 52/96 (54%) Frame = -2 Query: 642 EDVRLLHLNGVVINKMSTDKKVAEFFSRICPQGPIASKPNHLGNLFLKVKDHHTRKKNIW 463 ED+R+LHL G+++N+++ + + FF+RIC Q + S N+L +L L+V + + + W Sbjct: 266 EDMRILHLRGILVNQINGESDASRFFNRICSQ-VLWSNKNYLKDLMLEVNKYSGSRLHKW 324 Query: 462 MEEAKRKYCSSPXXXXXXXXXXXXXXXXXLQTSFTI 355 + R Y S+P LQT+FT+ Sbjct: 325 RAQLVRNYFSNPWVAMSVVAAVLLLGMTILQTTFTV 360