BLASTX nr result
ID: Zingiber25_contig00033104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00033104 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus... 57 3e-06 ref|XP_002299683.2| hypothetical protein POPTR_0001s21370g [Popu... 57 3e-06 ref|XP_006369339.1| hypothetical protein POPTR_0001s21370g [Popu... 57 3e-06 gb|EPS58242.1| hypothetical protein M569_16573, partial [Genlise... 57 3e-06 ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate com... 57 3e-06 gb|EOX98823.1| Endoplasmic reticulum vesicle transporter protein... 56 4e-06 ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Popu... 56 6e-06 gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein... 55 7e-06 >gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris] Length = 386 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 MEGI KLRNLD PKINEDF+SRTLSGG+IT Sbjct: 1 MEGIMSKLRNLDAYPKINEDFYSRTLSGGVIT 32 >ref|XP_002299683.2| hypothetical protein POPTR_0001s21370g [Populus trichocarpa] gi|550347814|gb|EEE84488.2| hypothetical protein POPTR_0001s21370g [Populus trichocarpa] Length = 363 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 MEGI+ KLRNLD PKINEDF+SRTLSGG+IT Sbjct: 1 MEGIYQKLRNLDAYPKINEDFYSRTLSGGLIT 32 >ref|XP_006369339.1| hypothetical protein POPTR_0001s21370g [Populus trichocarpa] gi|550347813|gb|ERP65908.1| hypothetical protein POPTR_0001s21370g [Populus trichocarpa] Length = 342 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 MEGI+ KLRNLD PKINEDF+SRTLSGG+IT Sbjct: 1 MEGIYQKLRNLDAYPKINEDFYSRTLSGGLIT 32 >gb|EPS58242.1| hypothetical protein M569_16573, partial [Genlisea aurea] Length = 153 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 ME IFGK R DVNPKINEDF+SRTLSGG IT Sbjct: 1 MESIFGKFRRFDVNPKINEDFYSRTLSGGAIT 32 >ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] gi|223546982|gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] Length = 386 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 MEGI KLRNLD PKINEDF+SRTLSGG+IT Sbjct: 1 MEGIMNKLRNLDAYPKINEDFYSRTLSGGVIT 32 >gb|EOX98823.1| Endoplasmic reticulum vesicle transporter protein [Theobroma cacao] Length = 386 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 ME +F KLRNLD PK+NEDF+SRTLSGGIIT Sbjct: 1 MENVFNKLRNLDAYPKVNEDFYSRTLSGGIIT 32 >ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa] gi|222856031|gb|EEE93578.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa] Length = 386 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 MEG+ KLRNLD PKINEDF+SRTLSGG+IT Sbjct: 1 MEGLMSKLRNLDAYPKINEDFYSRTLSGGVIT 32 >gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma cacao] Length = 386 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 97 MEGIFGKLRNLDVNPKINEDFHSRTLSGGIIT 2 M+GI KLRNLD PKINEDF+SRTLSGG+IT Sbjct: 1 MDGIMNKLRNLDAYPKINEDFYSRTLSGGVIT 32