BLASTX nr result
ID: Zingiber25_contig00032598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00032598 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513124.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002513124.1| conserved hypothetical protein [Ricinus communis] gi|223548135|gb|EEF49627.1| conserved hypothetical protein [Ricinus communis] Length = 220 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/87 (40%), Positives = 52/87 (59%) Frame = -3 Query: 262 MKHTNLDQVAGLPLRLVRYGAEAAAKFVAVSELNRICLHSDSCDGSRYKQKLDSPFAWMS 83 MK+T+ +QV G+P+ Y + + ++ S LN C + + KLDS F M+ Sbjct: 1 MKNTHQNQVIGIPISSELYLPDPSTQYHLPSSLN--------CSSTLTQCKLDSVFKMMN 52 Query: 82 KLTKKADSYLKGIRDHVSLGSKISETV 2 KL +KAD+ +GIR+HV LGS IS+TV Sbjct: 53 KLGRKADNIAQGIREHVRLGSNISQTV 79