BLASTX nr result
ID: Zingiber25_contig00032054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00032054 (709 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857018.1| hypothetical protein AMTR_s00197p00038370 [A... 62 1e-07 ref|XP_002530558.1| conserved hypothetical protein [Ricinus comm... 60 9e-07 >ref|XP_006857018.1| hypothetical protein AMTR_s00197p00038370 [Amborella trichopoda] gi|548861094|gb|ERN18485.1| hypothetical protein AMTR_s00197p00038370 [Amborella trichopoda] Length = 793 Score = 62.4 bits (150), Expect = 1e-07 Identities = 36/103 (34%), Positives = 59/103 (57%), Gaps = 9/103 (8%) Frame = +2 Query: 356 SIIIFNKWFKTRIRFSDIPEFSDLLFDKLQEQFDWLLSGMSHPAPSTFTRSYRE------ 517 SI I+NK I+F DI SDLL++++ + + L + P+T + + Sbjct: 66 SIDIWNKGSLISIKFIDILSLSDLLYEEMCRRLEQLFHALGL-LPTTVSPDLNQHYPNIS 124 Query: 518 ---ELILLFRCCMHMLPVLEFNLSLVVEKCAVVLSIIRRLCSP 637 E +LL RCC+ +LP+LEFN SLV+EK ++++ + +LC P Sbjct: 125 SISESVLLLRCCVVILPLLEFNQSLVLEKSRILVAALGKLCGP 167 >ref|XP_002530558.1| conserved hypothetical protein [Ricinus communis] gi|223529896|gb|EEF31826.1| conserved hypothetical protein [Ricinus communis] Length = 776 Score = 59.7 bits (143), Expect = 9e-07 Identities = 34/86 (39%), Positives = 54/86 (62%), Gaps = 9/86 (10%) Frame = +2 Query: 404 DIPEFSDLLFDKLQEQFDWLLS---------GMSHPAPSTFTRSYREELILLFRCCMHML 556 +I + SD+LF +L+ +F L S G + +T+ + EEL+LL RCCM ML Sbjct: 78 EIYDLSDVLFKELEWRFKELFSALHDVSATWGSGNSKLTTYIWAKSEELMLLLRCCMSML 137 Query: 557 PVLEFNLSLVVEKCAVVLSIIRRLCS 634 ++EFN +L++EK ++LS++RRL S Sbjct: 138 DLIEFNHNLLMEKGKLLLSVLRRLFS 163