BLASTX nr result
ID: Zingiber25_contig00031836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031836 (478 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320608.2| hypothetical protein POPTR_0014s18740g [Popu... 55 7e-06 >ref|XP_002320608.2| hypothetical protein POPTR_0014s18740g [Populus trichocarpa] gi|550324509|gb|EEE98923.2| hypothetical protein POPTR_0014s18740g [Populus trichocarpa] Length = 830 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +2 Query: 2 YPATYQVEAYPQPGYGQPSAAAVAPGFPQPVAAPQPYYGSY 124 YP TY +A+PQ Y QP AAA+ P QP + PQPYYGSY Sbjct: 790 YPPTYPAQAFPQQSYAQPPAAALTPA-QQPASVPQPYYGSY 829