BLASTX nr result
ID: Zingiber25_contig00031689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031689 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289639.1| PREDICTED: uncharacterized protein LOC101312... 82 6e-14 ref|XP_004500794.1| PREDICTED: uncharacterized protein LOC101488... 82 1e-13 ref|XP_004148831.1| PREDICTED: uncharacterized protein LOC101208... 82 1e-13 ref|XP_003603968.1| Sec14 cytosolic factor [Medicago truncatula]... 82 1e-13 gb|ESW07951.1| hypothetical protein PHAVU_009G006000g [Phaseolus... 80 2e-13 gb|ESW07950.1| hypothetical protein PHAVU_009G006000g [Phaseolus... 80 2e-13 ref|XP_003527164.1| PREDICTED: phosphatidylinositol/phosphatidyl... 80 2e-13 ref|XP_003522898.1| PREDICTED: phosphatidylinositol/phosphatidyl... 80 2e-13 ref|XP_002512943.1| phosphatidylinositol transporter, putative [... 80 3e-13 ref|XP_002281429.1| PREDICTED: uncharacterized protein LOC100248... 80 3e-13 ref|XP_004169138.1| PREDICTED: uncharacterized LOC101208172 [Cuc... 80 4e-13 ref|XP_002893058.1| hypothetical protein ARALYDRAFT_472189 [Arab... 79 5e-13 ref|XP_003606975.1| Sec14 cytosolic factor [Medicago truncatula]... 79 5e-13 ref|XP_006487243.1| PREDICTED: phosphatidylinositol/phosphatidyl... 79 6e-13 ref|XP_006423355.1| hypothetical protein CICLE_v10028023mg [Citr... 79 6e-13 ref|XP_006423354.1| hypothetical protein CICLE_v10028023mg [Citr... 79 6e-13 ref|XP_006423353.1| hypothetical protein CICLE_v10028023mg [Citr... 79 6e-13 gb|EOX97948.1| Sec14p-like phosphatidylinositol transfer family ... 79 6e-13 ref|XP_002283681.2| PREDICTED: uncharacterized protein LOC100252... 79 6e-13 gb|EMJ00957.1| hypothetical protein PRUPE_ppa002840mg [Prunus pe... 79 8e-13 >ref|XP_004289639.1| PREDICTED: uncharacterized protein LOC101312875 [Fragaria vesca subsp. vesca] Length = 627 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ+ELLAYIDR+EEAK RKKKFC+ Sbjct: 582 RVDALEAELIATKKALHEALMRQEELLAYIDRQEEAKFRKKKFCW 626 >ref|XP_004500794.1| PREDICTED: uncharacterized protein LOC101488984 [Cicer arietinum] Length = 626 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL+EALMRQ+ELLAYIDR+EEAKLRKKKFC+ Sbjct: 582 RVDALEAELIATKKALYEALMRQEELLAYIDRQEEAKLRKKKFCW 626 >ref|XP_004148831.1| PREDICTED: uncharacterized protein LOC101208172 [Cucumis sativus] Length = 623 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ+ELLAYID +EEAKLRKKKFC+ Sbjct: 579 RVDALEAELIATKKALHEALMRQEELLAYIDSQEEAKLRKKKFCW 623 >ref|XP_003603968.1| Sec14 cytosolic factor [Medicago truncatula] gi|355493016|gb|AES74219.1| Sec14 cytosolic factor [Medicago truncatula] Length = 623 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL+EALMRQ+ELLAYIDR+EEAKLRKKKFC+ Sbjct: 579 RVDALEAELIATKKALYEALMRQEELLAYIDRQEEAKLRKKKFCW 623 >gb|ESW07951.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris] Length = 498 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL++ALMRQ+ELLAYIDR+EEAKLRKKKFC+ Sbjct: 454 RVDALEAELIATKKALYDALMRQEELLAYIDRQEEAKLRKKKFCW 498 >gb|ESW07950.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris] Length = 625 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL++ALMRQ+ELLAYIDR+EEAKLRKKKFC+ Sbjct: 581 RVDALEAELIATKKALYDALMRQEELLAYIDRQEEAKLRKKKFCW 625 >ref|XP_003527164.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Glycine max] Length = 623 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL++ALMRQ+ELLAYIDR+EEAKLRKKKFC+ Sbjct: 579 RVDALEAELIATKKALYDALMRQEELLAYIDRQEEAKLRKKKFCW 623 >ref|XP_003522898.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Glycine max] Length = 624 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL++ALMRQ+ELLAYIDR+EEAKLRKKKFC+ Sbjct: 580 RVDALEAELIATKKALYDALMRQEELLAYIDRQEEAKLRKKKFCW 624 >ref|XP_002512943.1| phosphatidylinositol transporter, putative [Ricinus communis] gi|223547954|gb|EEF49446.1| phosphatidylinositol transporter, putative [Ricinus communis] Length = 624 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ+ELLAYID +EEAK RKKKFC+ Sbjct: 580 RVDALEAELIATKKALHEALMRQEELLAYIDSQEEAKFRKKKFCW 624 >ref|XP_002281429.1| PREDICTED: uncharacterized protein LOC100248963 isoform 2 [Vitis vinifera] gi|302142538|emb|CBI19741.3| unnamed protein product [Vitis vinifera] Length = 623 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ+ELLAYIDR+EEAK +KKKFC+ Sbjct: 579 RVDALEAELIATKKALHEALMRQEELLAYIDRQEEAKSQKKKFCW 623 >ref|XP_004169138.1| PREDICTED: uncharacterized LOC101208172 [Cucumis sativus] Length = 623 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RV+ALEAELI TKKALHEALMRQ+ELLAYID +EEAKLRKKKFC+ Sbjct: 579 RVNALEAELIATKKALHEALMRQEELLAYIDSQEEAKLRKKKFCW 623 >ref|XP_002893058.1| hypothetical protein ARALYDRAFT_472189 [Arabidopsis lyrata subsp. lyrata] gi|297338900|gb|EFH69317.1| hypothetical protein ARALYDRAFT_472189 [Arabidopsis lyrata subsp. lyrata] Length = 613 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ+ELL YIDR+EEAK R+KKFC+ Sbjct: 569 RVDALEAELITTKKALHEALMRQEELLGYIDRQEEAKYRRKKFCW 613 >ref|XP_003606975.1| Sec14 cytosolic factor [Medicago truncatula] gi|355508030|gb|AES89172.1| Sec14 cytosolic factor [Medicago truncatula] Length = 620 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKAL+EALMRQ+ELLAYID +EEAKLRKKKFC+ Sbjct: 576 RVDALEAELIATKKALYEALMRQEELLAYIDSQEEAKLRKKKFCW 620 >ref|XP_006487243.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Citrus sinensis] Length = 623 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ++LLAYIDR+EEAK RKKK C+ Sbjct: 579 RVDALEAELIATKKALHEALMRQEDLLAYIDRQEEAKFRKKKLCW 623 >ref|XP_006423355.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] gi|557525289|gb|ESR36595.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] Length = 624 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ++LLAYIDR+EEAK RKKK C+ Sbjct: 580 RVDALEAELIATKKALHEALMRQEDLLAYIDRQEEAKFRKKKLCW 624 >ref|XP_006423354.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] gi|557525288|gb|ESR36594.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] Length = 623 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ++LLAYIDR+EEAK RKKK C+ Sbjct: 579 RVDALEAELIATKKALHEALMRQEDLLAYIDRQEEAKFRKKKLCW 623 >ref|XP_006423353.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] gi|557525287|gb|ESR36593.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] Length = 527 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ++LLAYIDR+EEAK RKKK C+ Sbjct: 483 RVDALEAELIATKKALHEALMRQEDLLAYIDRQEEAKFRKKKLCW 527 >gb|EOX97948.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] gi|508706053|gb|EOX97949.1| Sec14p-like phosphatidylinositol transfer family protein isoform 1 [Theobroma cacao] Length = 626 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEALMRQ+ELLAYID + EAKLRKKKFC+ Sbjct: 582 RVDALEAELIATKKALHEALMRQEELLAYIDSQVEAKLRKKKFCW 626 >ref|XP_002283681.2| PREDICTED: uncharacterized protein LOC100252199 [Vitis vinifera] gi|297744421|emb|CBI37683.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKFCF 137 RVDALEAELI TKKALHEAL+RQ+ELLAYID +EEAK RKKKFC+ Sbjct: 581 RVDALEAELIATKKALHEALLRQEELLAYIDSQEEAKFRKKKFCW 625 >gb|EMJ00957.1| hypothetical protein PRUPE_ppa002840mg [Prunus persica] Length = 628 Score = 78.6 bits (192), Expect = 8e-13 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +3 Query: 3 RVDALEAELIVTKKALHEALMRQDELLAYIDREEEAKLRKKKF 131 RVDALEAELI TKKALHEALMRQ+ELLAYIDR+EEAKL+KKKF Sbjct: 583 RVDALEAELIATKKALHEALMRQEELLAYIDRQEEAKLQKKKF 625