BLASTX nr result
ID: Zingiber25_contig00031600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031600 (504 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239023.1| PREDICTED: uncharacterized protein LOC101260... 56 4e-06 gb|EMJ23184.1| hypothetical protein PRUPE_ppa002846mg [Prunus pe... 56 6e-06 ref|XP_006348651.1| PREDICTED: stress response protein NST1-like... 55 1e-05 >ref|XP_004239023.1| PREDICTED: uncharacterized protein LOC101260227 [Solanum lycopersicum] Length = 545 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 503 HPDRASRSDIRKQVEAEETFKMISRLKEKLLPAL 402 HPDRASRSD+++QVEAEE FK+ISR+K+K LP L Sbjct: 512 HPDRASRSDLQQQVEAEEKFKLISRMKDKYLPTL 545 >gb|EMJ23184.1| hypothetical protein PRUPE_ppa002846mg [Prunus persica] Length = 628 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 503 HPDRASRSDIRKQVEAEETFKMISRLKEKLL 411 HPDRASR+D+R+QVEAEE FK+ISR+KEKLL Sbjct: 593 HPDRASRTDVRQQVEAEEKFKLISRMKEKLL 623 >ref|XP_006348651.1| PREDICTED: stress response protein NST1-like [Solanum tuberosum] Length = 544 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -2 Query: 503 HPDRASRSDIRKQVEAEETFKMISRLKEKLLPAL 402 HPDRAS+SD+++QVEAEE FK+ISR+K+K LP+L Sbjct: 511 HPDRASQSDLQQQVEAEEKFKLISRMKDKYLPSL 544