BLASTX nr result
ID: Zingiber25_contig00031302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031302 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547879.1| PREDICTED: SRSF protein kinase 1-like [Glyci... 78 1e-12 ref|XP_002332363.1| predicted protein [Populus trichocarpa] gi|5... 78 1e-12 gb|ESW28242.1| hypothetical protein PHAVU_003G270500g [Phaseolus... 74 2e-11 gb|EOX90644.1| Kinesin motor family protein isoform 2 [Theobroma... 74 2e-11 gb|EOX90643.1| Kinase superfamily protein isoform 1 [Theobroma c... 74 2e-11 ref|XP_006412096.1| hypothetical protein EUTSA_v10025221mg [Eutr... 73 3e-11 ref|XP_003629120.1| Serine/threonine protein kinase SRPK1 [Medic... 73 3e-11 ref|XP_003608174.1| Serine/threonine protein kinase SRPK1 [Medic... 73 3e-11 ref|XP_002521726.1| srpk, putative [Ricinus communis] gi|2235391... 73 4e-11 ref|XP_002277212.1| PREDICTED: serine/threonine-protein kinase S... 73 4e-11 emb|CAN70006.1| hypothetical protein VITISV_038749 [Vitis vinifera] 73 4e-11 ref|XP_006855718.1| hypothetical protein AMTR_s00044p00150270 [A... 72 6e-11 ref|XP_002307217.1| kinase family protein [Populus trichocarpa] ... 72 6e-11 ref|XP_004512277.1| PREDICTED: SRSF protein kinase 1-like [Cicer... 63 8e-11 ref|NP_179344.1| putative protein kinase [Arabidopsis thaliana] ... 72 1e-10 ref|XP_006297706.1| hypothetical protein CARUB_v10013734mg [Caps... 72 1e-10 gb|AFK42375.1| unknown [Medicago truncatula] 72 1e-10 ref|XP_002884066.1| kinase family protein [Arabidopsis lyrata su... 72 1e-10 ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arab... 72 1e-10 ref|NP_195275.1| protein kinase family protein [Arabidopsis thal... 71 1e-10 >ref|XP_003547879.1| PREDICTED: SRSF protein kinase 1-like [Glycine max] Length = 445 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/65 (61%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP L KLL+++YKF E DAC+F+EFL PLLD A E RPTA Q+C Sbjct: 355 GDLKRIRRLKFWP-LSKLLIDRYKFSERDACEFSEFLLPLLDFAPEKRPTA------QQC 407 Query: 152 -KAPW 141 + PW Sbjct: 408 LQLPW 412 >ref|XP_002332363.1| predicted protein [Populus trichocarpa] gi|566197077|ref|XP_006376788.1| hypothetical protein POPTR_0012s06410g [Populus trichocarpa] gi|550326506|gb|ERP54585.1| hypothetical protein POPTR_0012s06410g [Populus trichocarpa] Length = 442 Score = 77.8 bits (190), Expect = 1e-12 Identities = 42/65 (64%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD+LLVEKYKFPE DA + EFL PLLD ENRPTA Q+C Sbjct: 354 GDLKRIRRLKFWP-LDRLLVEKYKFPETDAQEIAEFLCPLLDFTPENRPTA------QQC 406 Query: 152 -KAPW 141 + PW Sbjct: 407 LQHPW 411 >gb|ESW28242.1| hypothetical protein PHAVU_003G270500g [Phaseolus vulgaris] Length = 437 Score = 74.3 bits (181), Expect = 2e-11 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP L KLLVE+YKF E+DA +F+EF+ PLLD E RPTA Q+C Sbjct: 354 GDLKRIRRLKFWP-LSKLLVERYKFSESDAHEFSEFVLPLLDFTPEKRPTA------QKC 406 Query: 152 -KAPWRTK*SHSRG 114 + PW K + G Sbjct: 407 LEHPWLKKMENESG 420 >gb|EOX90644.1| Kinesin motor family protein isoform 2 [Theobroma cacao] Length = 441 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/65 (61%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD+LLVEKY+F E+DA +F EFL PLLD + E RPTA Q+C Sbjct: 358 GDLKRIRRLKFWP-LDRLLVEKYEFSESDAREFAEFLCPLLDFSPEKRPTA------QQC 410 Query: 152 -KAPW 141 + PW Sbjct: 411 LQHPW 415 >gb|EOX90643.1| Kinase superfamily protein isoform 1 [Theobroma cacao] Length = 440 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/65 (61%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD+LLVEKY+F E+DA +F EFL PLLD + E RPTA Q+C Sbjct: 357 GDLKRIRRLKFWP-LDRLLVEKYEFSESDAREFAEFLCPLLDFSPEKRPTA------QQC 409 Query: 152 -KAPW 141 + PW Sbjct: 410 LQHPW 414 >ref|XP_006412096.1| hypothetical protein EUTSA_v10025221mg [Eutrema salsugineum] gi|557113266|gb|ESQ53549.1| hypothetical protein EUTSA_v10025221mg [Eutrema salsugineum] Length = 440 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/72 (52%), Positives = 50/72 (69%), Gaps = 1/72 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR K+WP LD+LL++KYK P+A+A +F EFL P+L+ A E RPTA Q+C Sbjct: 360 GDLKRIRRLKYWP-LDRLLIDKYKLPDAEAKEFAEFLSPILEFAPEKRPTA------QQC 412 Query: 152 KA-PWRTK*SHS 120 A PW +H+ Sbjct: 413 LAHPWMNVSTHN 424 >ref|XP_003629120.1| Serine/threonine protein kinase SRPK1 [Medicago truncatula] gi|355523142|gb|AET03596.1| Serine/threonine protein kinase SRPK1 [Medicago truncatula] Length = 1025 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/64 (59%), Positives = 46/64 (71%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP L+KLL+E+YK E+DA +F+EFL PLLD A E RPTA +Q Sbjct: 935 GDLKRIRRLKFWP-LNKLLIERYKLSESDAHEFSEFLLPLLDFAPEKRPTA-----EQCL 988 Query: 152 KAPW 141 + PW Sbjct: 989 QHPW 992 >ref|XP_003608174.1| Serine/threonine protein kinase SRPK1 [Medicago truncatula] gi|355509229|gb|AES90371.1| Serine/threonine protein kinase SRPK1 [Medicago truncatula] Length = 131 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/64 (59%), Positives = 46/64 (71%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP L+KLL+E+YK E+DA +F+EFL PLLD A E RPTA +Q Sbjct: 41 GDLKRIRRLKFWP-LNKLLIERYKLSESDAHEFSEFLLPLLDFAPEKRPTA-----EQCL 94 Query: 152 KAPW 141 + PW Sbjct: 95 QHPW 98 >ref|XP_002521726.1| srpk, putative [Ricinus communis] gi|223539117|gb|EEF40713.1| srpk, putative [Ricinus communis] Length = 445 Score = 72.8 bits (177), Expect = 4e-11 Identities = 40/65 (61%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD+LLV+KYKF E DA +F EFL PLLD E RPTA Q+C Sbjct: 355 GDLKRIRRLKFWP-LDRLLVDKYKFSENDAKEFAEFLCPLLDFVPEKRPTA------QQC 407 Query: 152 -KAPW 141 + PW Sbjct: 408 LQHPW 412 >ref|XP_002277212.1| PREDICTED: serine/threonine-protein kinase SRPK2 [Vitis vinifera] gi|296082557|emb|CBI21562.3| unnamed protein product [Vitis vinifera] Length = 444 Score = 72.8 bits (177), Expect = 4e-11 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD++LV++YKF E+DA +F +FL PLLD A E RPTA Q+C Sbjct: 354 GDLKRIRRLKFWP-LDRILVDRYKFSESDAREFADFLVPLLDFAPEKRPTA------QQC 406 Query: 152 -KAPW 141 + PW Sbjct: 407 LQHPW 411 >emb|CAN70006.1| hypothetical protein VITISV_038749 [Vitis vinifera] Length = 463 Score = 72.8 bits (177), Expect = 4e-11 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD++LV++YKF E+DA +F +FL PLLD A E RPTA Q+C Sbjct: 356 GDLKRIRRLKFWP-LDRILVDRYKFSESDAREFADFLVPLLDFAPEKRPTA------QQC 408 Query: 152 -KAPW 141 + PW Sbjct: 409 LQHPW 413 >ref|XP_006855718.1| hypothetical protein AMTR_s00044p00150270 [Amborella trichopoda] gi|548859505|gb|ERN17185.1| hypothetical protein AMTR_s00044p00150270 [Amborella trichopoda] Length = 455 Score = 72.4 bits (176), Expect = 6e-11 Identities = 39/64 (60%), Positives = 42/64 (65%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD+LLVEKY F E DA +F EFL P LD A E RPTA + Sbjct: 362 GDLKRIRRLKFWP-LDRLLVEKYAFSEIDAKEFAEFLLPFLDFAPEKRPTA-----EHCL 415 Query: 152 KAPW 141 K PW Sbjct: 416 KHPW 419 >ref|XP_002307217.1| kinase family protein [Populus trichocarpa] gi|222856666|gb|EEE94213.1| kinase family protein [Populus trichocarpa] Length = 442 Score = 72.4 bits (176), Expect = 6e-11 Identities = 40/65 (61%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP LD+LLVEKYKF E DA +F EFL PL D E RPTA Q+C Sbjct: 354 GDLKRIRRLKFWP-LDRLLVEKYKFSENDAREFAEFLCPLFDFTPEKRPTA------QQC 406 Query: 152 -KAPW 141 + PW Sbjct: 407 LQHPW 411 >ref|XP_004512277.1| PREDICTED: SRSF protein kinase 1-like [Cicer arietinum] Length = 445 Score = 63.2 bits (152), Expect(2) = 8e-11 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTA 180 GDLKR RR K+ P LDKLL+++YKF DA +F+EFL PL D A E RPTA Sbjct: 355 GDLKRIRRLKYLP-LDKLLIDRYKFSVNDAHEFSEFLLPLFDFAPEKRPTA 404 Score = 28.9 bits (63), Expect(2) = 8e-11 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -3 Query: 178 HPWLRIKDAKPRGEQNEAILE---VALTKLKVQV 86 HPWL K++ P +NE+ +E V ++ L+++V Sbjct: 410 HPWLNCKESAPNEMRNESTVEKVNVGMSNLQIKV 443 >ref|NP_179344.1| putative protein kinase [Arabidopsis thaliana] gi|334184271|ref|NP_001189542.1| putative protein kinase [Arabidopsis thaliana] gi|4914374|gb|AAD32910.1| putative protein kinase [Arabidopsis thaliana] gi|9843645|emb|CAC03676.1| SRPK2 [Arabidopsis thaliana] gi|51969504|dbj|BAD43444.1| putative protein kinase [Arabidopsis thaliana] gi|51970286|dbj|BAD43835.1| putative protein kinase [Arabidopsis thaliana] gi|111074454|gb|ABH04600.1| At2g17530 [Arabidopsis thaliana] gi|330251548|gb|AEC06642.1| putative protein kinase [Arabidopsis thaliana] gi|330251550|gb|AEC06644.1| putative protein kinase [Arabidopsis thaliana] Length = 440 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR K+WP LD+LL++KYK PEA+A +F +FL P++D A E RPTA Q+C Sbjct: 357 GDLKRIRRLKYWP-LDRLLIDKYKLPEAEAREFADFLCPIMDFAPEKRPTA------QQC 409 Query: 152 -KAPW 141 + PW Sbjct: 410 LQHPW 414 >ref|XP_006297706.1| hypothetical protein CARUB_v10013734mg [Capsella rubella] gi|482566415|gb|EOA30604.1| hypothetical protein CARUB_v10013734mg [Capsella rubella] Length = 437 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR K+WP LD+LL++KYK PEA+A +F +FL P++D A E RPTA Q+C Sbjct: 357 GDLKRIRRLKYWP-LDRLLIDKYKLPEAEAREFADFLCPIMDFAPEKRPTA------QQC 409 Query: 152 -KAPW 141 + PW Sbjct: 410 LQHPW 414 >gb|AFK42375.1| unknown [Medicago truncatula] Length = 152 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/64 (57%), Positives = 45/64 (70%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR KFWP L+KLL+E+YK E+DA +F+EF PLLD A E RPTA +Q Sbjct: 62 GDLKRIRRLKFWP-LNKLLIERYKLSESDAHEFSEFFLPLLDFAPEKRPTA-----EQCL 115 Query: 152 KAPW 141 + PW Sbjct: 116 QHPW 119 >ref|XP_002884066.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297329906|gb|EFH60325.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR K+WP LD+LL++KYK PEA++ +F EFL P++D A E RPTA Q+C Sbjct: 357 GDLKRIRRLKYWP-LDRLLIDKYKLPEAESREFAEFLCPIMDFAPEKRPTA------QQC 409 Query: 152 -KAPW 141 + PW Sbjct: 410 LQHPW 414 >ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] gi|297329905|gb|EFH60324.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR K+WP LD+LL++KYK PEA++ +F EFL P++D A E RPTA Q+C Sbjct: 973 GDLKRIRRLKYWP-LDRLLIDKYKLPEAESREFAEFLCPIMDFAPEKRPTA------QQC 1025 Query: 152 -KAPW 141 + PW Sbjct: 1026 LQHPW 1030 >ref|NP_195275.1| protein kinase family protein [Arabidopsis thaliana] gi|3367568|emb|CAA20020.1| protein kinase - like protein [Arabidopsis thaliana] gi|7270501|emb|CAB80266.1| protein kinase-like protein [Arabidopsis thaliana] gi|26452883|dbj|BAC43520.1| putative protein kinase [Arabidopsis thaliana] gi|28972997|gb|AAO63823.1| putative protein kinase [Arabidopsis thaliana] gi|332661122|gb|AEE86522.1| protein kinase family protein [Arabidopsis thaliana] Length = 438 Score = 71.2 bits (173), Expect = 1e-10 Identities = 37/65 (56%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = -2 Query: 332 GDLKRTRRSKFWPPLDKLLVEKYKFPEADACKFTEFLYPLLDIASENRPTAASMA*DQRC 153 GDLKR RR K+WP LD+LL++KYK PEA+A +F EFL P+L+ A E RPTA Q+C Sbjct: 358 GDLKRIRRLKYWP-LDRLLIDKYKLPEAEAKEFAEFLTPILEFAPEKRPTA------QQC 410 Query: 152 -KAPW 141 PW Sbjct: 411 LDHPW 415