BLASTX nr result
ID: Zingiber25_contig00031271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031271 (353 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006472405.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_006433766.1| hypothetical protein CICLE_v10000605mg [Citr... 70 3e-10 ref|XP_002285611.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 emb|CAN61988.1| hypothetical protein VITISV_026694 [Vitis vinifera] 68 1e-09 ref|XP_002527349.1| pentatricopeptide repeat-containing protein,... 67 3e-09 ref|XP_006364562.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006360522.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_004240633.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006306156.1| hypothetical protein CARUB_v10011677mg, part... 65 7e-09 gb|ESW09655.1| hypothetical protein PHAVU_009G145100g [Phaseolus... 64 2e-08 ref|XP_003527866.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003523769.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002889775.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_004288876.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|NP_172461.1| pentatricopeptide repeat-containing protein [Ar... 64 3e-08 ref|XP_002302359.2| hypothetical protein POPTR_0002s11020g [Popu... 62 6e-08 ref|XP_002302360.1| predicted protein [Populus trichocarpa] 62 6e-08 ref|XP_004170776.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006856585.1| hypothetical protein AMTR_s00046p00202770 [A... 60 2e-07 gb|EPS61251.1| hypothetical protein M569_13548, partial [Genlise... 59 5e-07 >ref|XP_006472405.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Citrus sinensis] Length = 619 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = -2 Query: 184 HVASXXXXXXXXXXXXPSNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGF 5 H++S SN HL RLV GEL+E +F+ESMV G++P+IIPCTSLIRGF Sbjct: 109 HISSGMENSSLNFEDFESNNHLRRLVRNGELEEGFKFLESMVYHGDIPDIIPCTSLIRGF 168 Query: 4 C 2 C Sbjct: 169 C 169 >ref|XP_006433766.1| hypothetical protein CICLE_v10000605mg [Citrus clementina] gi|557535888|gb|ESR47006.1| hypothetical protein CICLE_v10000605mg [Citrus clementina] Length = 619 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = -2 Query: 184 HVASXXXXXXXXXXXXPSNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGF 5 H++S SN HL RLV GEL+E +F+ESMV G++P+IIPCTSLIRGF Sbjct: 109 HISSGMENSSLNFEDFESNNHLRRLVRNGELEEGFKFLESMVYHGDIPDIIPCTSLIRGF 168 Query: 4 C 2 C Sbjct: 169 C 169 >ref|XP_002285611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like isoform 1 [Vitis vinifera] Length = 610 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL RLV GEL++ +F+ESMV +G++P+IIPCTSLIRGFC Sbjct: 117 SNNHLRRLVRNGELEDGFKFLESMVYRGDIPDIIPCTSLIRGFC 160 >emb|CAN61988.1| hypothetical protein VITISV_026694 [Vitis vinifera] Length = 553 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL RLV GEL++ +F+ESMV +G++P+IIPCTSLIRGFC Sbjct: 60 SNNHLRRLVRNGELEDGFKFLESMVYRGDIPDIIPCTSLIRGFC 103 >ref|XP_002527349.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533268|gb|EEF35021.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 443 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN +L +LV GEL+E RF+ESMV +G++P+IIPCTSLIRGFC Sbjct: 87 SNNNLSKLVRNGELEEGFRFLESMVYRGDIPDIIPCTSLIRGFC 130 >ref|XP_006364562.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Solanum tuberosum] Length = 623 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN +L RLV GEL+ES + +ESMV +G++P+IIPCTSLIRGFC Sbjct: 130 SNNYLRRLVRNGELEESFKHLESMVYRGDIPDIIPCTSLIRGFC 173 >ref|XP_006360522.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Solanum tuberosum] Length = 486 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN +L RLV GEL+ES + +ESMV +G++P+IIPCTSLIRGFC Sbjct: 130 SNNYLRRLVRNGELEESFKHLESMVYRGDIPDIIPCTSLIRGFC 173 >ref|XP_004240633.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Solanum lycopersicum] Length = 739 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN +L RLV GEL+ES + +ESMV +G++P+IIPCTSLIRGFC Sbjct: 126 SNNYLRRLVRNGELEESFKHLESMVYRGDIPDIIPCTSLIRGFC 169 >ref|XP_006306156.1| hypothetical protein CARUB_v10011677mg, partial [Capsella rubella] gi|482574867|gb|EOA39054.1| hypothetical protein CARUB_v10011677mg, partial [Capsella rubella] Length = 609 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E RF+E+MV G VP+IIPCT+LIRGFC Sbjct: 107 SNNHLRQLVRTGELEEGFRFLENMVYHGNVPDIIPCTTLIRGFC 150 >gb|ESW09655.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris] Length = 600 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E L+F+E M+ QG++P++I CTSLIRGFC Sbjct: 107 SNIHLRKLVRNGELEEGLKFLERMIYQGDIPDVIACTSLIRGFC 150 >ref|XP_003527866.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Glycine max] Length = 603 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E L+F+E M+ QG++P++I CTSLIRGFC Sbjct: 110 SNIHLRKLVRNGELEEGLKFLERMIYQGDIPDVIACTSLIRGFC 153 >ref|XP_003523769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Glycine max] Length = 602 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E L+F+E M+ QG++P++I CTSLIRGFC Sbjct: 109 SNIHLRKLVRNGELEEGLKFLERMIYQGDIPDVIACTSLIRGFC 152 >ref|XP_002889775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335617|gb|EFH66034.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 598 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E +F+E+MV G VP+IIPCT+LIRGFC Sbjct: 105 SNNHLRQLVRTGELEEGFKFLENMVYHGNVPDIIPCTTLIRGFC 148 >ref|XP_004288876.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Fragaria vesca subsp. vesca] Length = 605 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN L RLV GEL+E R +ESMV QG++P+II CTSLIRGFC Sbjct: 112 SNNQLRRLVRNGELEEGFRLLESMVYQGDIPDIIACTSLIRGFC 155 >ref|NP_172461.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122215618|sp|Q3EDF8.1|PPR28_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09900 gi|332190391|gb|AEE28512.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 598 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL ++V GEL+E +F+E+MV G VP+IIPCT+LIRGFC Sbjct: 105 SNNHLRQMVRTGELEEGFKFLENMVYHGNVPDIIPCTTLIRGFC 148 >ref|XP_002302359.2| hypothetical protein POPTR_0002s11020g [Populus trichocarpa] gi|550344756|gb|EEE81632.2| hypothetical protein POPTR_0002s11020g [Populus trichocarpa] Length = 637 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E RF+E+MV +GE+P+II TSLIRGFC Sbjct: 144 SNNHLRKLVRNGELEEGFRFLENMVYRGEIPDIIASTSLIRGFC 187 >ref|XP_002302360.1| predicted protein [Populus trichocarpa] Length = 215 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN HL +LV GEL+E RF+E+MV +GE+P+II TSLIRGFC Sbjct: 144 SNNHLRKLVRNGELEEGFRFLENMVYRGEIPDIIASTSLIRGFC 187 >ref|XP_004170776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Cucumis sativus] Length = 665 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 +N HL RLV GEL+E +F+E MV +G++P+II CTSLIRG C Sbjct: 113 NNNHLRRLVRNGELEEGFKFLEDMVCRGDIPDIIACTSLIRGLC 156 >ref|XP_006856585.1| hypothetical protein AMTR_s00046p00202770 [Amborella trichopoda] gi|548860466|gb|ERN18052.1| hypothetical protein AMTR_s00046p00202770 [Amborella trichopoda] Length = 585 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 133 SNEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 SN+ L R V GEL+E+L F+E+M GE+P+IIPCTSLIRGFC Sbjct: 112 SNDLLKRHVRNGELEEALVFLENMARNGEIPDIIPCTSLIRGFC 155 >gb|EPS61251.1| hypothetical protein M569_13548, partial [Genlisea aurea] Length = 488 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -2 Query: 130 NEHLLRLVHRGELDESLRFVESMVVQGEVPNIIPCTSLIRGFC 2 N L RLV G+L+++LR ++ MV Q E+P+IIPCTSLIRGFC Sbjct: 1 NSSLRRLVRHGQLEKALRHIQGMVSQREIPDIIPCTSLIRGFC 43