BLASTX nr result
ID: Zingiber25_contig00031270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031270 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76432.1| hypothetical protein VITISV_033849 [Vitis vinifera] 47 7e-07 >emb|CAN76432.1| hypothetical protein VITISV_033849 [Vitis vinifera] Length = 1126 Score = 46.6 bits (109), Expect(2) = 7e-07 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = +3 Query: 87 IRSSLLNSNDKLANLSTKLLRGLMV*YIYNKLGIYNICEPS 209 + +S +NSND+LA++ TK LRG + YI NKLG YNI P+ Sbjct: 1086 VATSFVNSNDQLADIFTKSLRGPRIKYICNKLGAYNIYAPA 1126 Score = 32.0 bits (71), Expect(2) = 7e-07 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 2 CISFRVSYSIRG*SIEKLIHFIREKVQSNKIVTS 103 CI + S++G + KL HFIREK+ S + TS Sbjct: 1056 CILHPIQSSMKGPNTLKLTHFIREKIASGCVATS 1089