BLASTX nr result
ID: Zingiber25_contig00031085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00031085 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006394607.1| hypothetical protein EUTSA_v10003885mg [Eutr... 57 3e-06 >ref|XP_006394607.1| hypothetical protein EUTSA_v10003885mg [Eutrema salsugineum] gi|312283045|dbj|BAJ34388.1| unnamed protein product [Thellungiella halophila] gi|557091246|gb|ESQ31893.1| hypothetical protein EUTSA_v10003885mg [Eutrema salsugineum] Length = 587 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 106 APCSKEDMAALLTFKSSILEDSTGILSSWTGNDCC 2 A CS +D AALL FKSSI++D+TG+LSSW G DCC Sbjct: 27 AICSSQDRAALLGFKSSIIKDTTGVLSSWVGKDCC 61