BLASTX nr result
ID: Zingiber25_contig00030913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00030913 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143512.1| PREDICTED: methyltransferase-like protein 21... 56 4e-06 >ref|XP_004143512.1| PREDICTED: methyltransferase-like protein 21C-like [Cucumis sativus] gi|449519816|ref|XP_004166930.1| PREDICTED: methyltransferase-like protein 21C-like [Cucumis sativus] Length = 267 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -3 Query: 419 WKNRDAVFFRKARKVFDESLLHTDRPLPGKRVGVAICRFTEKTSIK 282 WK +D+ FFRKARK F+ +LHTD P PG R GV + RFT K S K Sbjct: 214 WK-KDSAFFRKARKFFEVEVLHTDPPPPGSRTGVVVYRFTAKLSKK 258