BLASTX nr result
ID: Zingiber25_contig00030782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00030782 (267 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306964.1| PREDICTED: CCR4-NOT transcription complex su... 55 7e-06 ref|XP_002270543.2| PREDICTED: CCR4-NOT transcription complex su... 55 7e-06 >ref|XP_004306964.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like [Fragaria vesca subsp. vesca] Length = 2328 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +2 Query: 122 AGQIRFLLHSVNEFNFDSTLRELFQLVECGSDGSTFLLQMCLDQI 256 A QIRFLL S+N+ N DS LREL Q +E G +GS LLQ CLD + Sbjct: 9 ANQIRFLLQSLNDANSDSVLRELTQFIEYGIEGSILLLQTCLDHL 53 >ref|XP_002270543.2| PREDICTED: CCR4-NOT transcription complex subunit 1-like [Vitis vinifera] Length = 1586 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = +2 Query: 89 DAAAMLSSFIFAGQIRFLLHSVNEFNFDST----LRELFQLVECGSDGSTFLLQMCLDQI 256 D+ ML S + + QIRFLLH +N+ NFDS +REL Q +E G + S LLQ CLD + Sbjct: 172 DSMKMLFSSLISSQIRFLLHGLNDSNFDSNFDSVVRELCQFIEYGYEASILLLQTCLDHM 231