BLASTX nr result
ID: Zingiber25_contig00029952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029952 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162128.1| PREDICTED: uncharacterized protein LOC101226... 55 7e-06 ref|XP_004152517.1| PREDICTED: uncharacterized protein LOC101213... 55 7e-06 gb|ADN33955.1| hypothetical protein [Cucumis melo subsp. melo] 55 7e-06 >ref|XP_004162128.1| PREDICTED: uncharacterized protein LOC101226218 [Cucumis sativus] Length = 277 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -2 Query: 319 CRMRVHYARPTGRA-SSLAAPCDVWRLDGGGSAWRIDVK 206 CR++V Y G+ SSL APCD WR+DGGG AWR+DVK Sbjct: 230 CRVKVQYRSRWGKEKSSLTAPCDAWRMDGGGFAWRLDVK 268 >ref|XP_004152517.1| PREDICTED: uncharacterized protein LOC101213560 [Cucumis sativus] Length = 277 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -2 Query: 319 CRMRVHYARPTGRA-SSLAAPCDVWRLDGGGSAWRIDVK 206 CR++V Y G+ SSL APCD WR+DGGG AWR+DVK Sbjct: 230 CRVKVQYRSRWGKEKSSLTAPCDAWRMDGGGFAWRLDVK 268 >gb|ADN33955.1| hypothetical protein [Cucumis melo subsp. melo] Length = 275 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -2 Query: 319 CRMRVHYARPTGRA-SSLAAPCDVWRLDGGGSAWRIDVK 206 CR++V Y G+ SSL APCD WR+DGGG AWR+DVK Sbjct: 228 CRVKVQYRSRWGKERSSLTAPCDAWRMDGGGFAWRLDVK 266