BLASTX nr result
ID: Zingiber25_contig00029885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029885 (652 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369502.1| hypothetical protein POPTR_0001s24040g [Popu... 59 2e-06 gb|EXB53239.1| Nuclear factor related to kappa-B-binding protein... 58 2e-06 ref|XP_002313459.2| hypothetical protein POPTR_0009s03120g [Popu... 57 5e-06 >ref|XP_006369502.1| hypothetical protein POPTR_0001s24040g [Populus trichocarpa] gi|566150688|ref|XP_002298386.2| hypothetical protein POPTR_0001s24040g [Populus trichocarpa] gi|550348052|gb|ERP66071.1| hypothetical protein POPTR_0001s24040g [Populus trichocarpa] gi|550348053|gb|EEE83191.2| hypothetical protein POPTR_0001s24040g [Populus trichocarpa] Length = 1416 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = +1 Query: 1 VLTSPIRAAAEDAGLNIDNANAFIDSTTITKDRGNWEGLALNPLRQDRLICQENST-DDF 177 ++ S +R AED NID ++ +T D W+ L+LNPL+++++ICQENST +DF Sbjct: 1341 LVCSDVRHNAED---NIDTSHGPKQGSTYDGDAMVWDALSLNPLQENKVICQENSTNEDF 1397 Query: 178 DDGTFGQEQP 207 DD TF +E+P Sbjct: 1398 DDETFERERP 1407 >gb|EXB53239.1| Nuclear factor related to kappa-B-binding protein [Morus notabilis] Length = 1378 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/36 (66%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +1 Query: 106 WEGLALNPLRQDRLICQENST-DDFDDGTFGQEQPI 210 WEGL LNP+R+++L+CQENST +DFDD TFG+E+P+ Sbjct: 1335 WEGLDLNPIRENKLLCQENSTNEDFDDETFGRERPV 1370 >ref|XP_002313459.2| hypothetical protein POPTR_0009s03120g [Populus trichocarpa] gi|566186047|ref|XP_006379006.1| hypothetical protein POPTR_0009s03120g [Populus trichocarpa] gi|550330929|gb|EEE87414.2| hypothetical protein POPTR_0009s03120g [Populus trichocarpa] gi|550330930|gb|ERP56803.1| hypothetical protein POPTR_0009s03120g [Populus trichocarpa] Length = 1404 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +1 Query: 1 VLTSPIRAAAEDAGLNIDNANAFIDSTTITKDRGNWEGLALNPLRQDRLICQENST-DDF 177 ++ S +R +AED +D + +T + WE L+LNPL +++LICQE+ST +DF Sbjct: 1329 LVCSDVRQSAEDT---VDTTHGLQQGSTYQGESMVWEALSLNPLEENKLICQEDSTNEDF 1385 Query: 178 DDGTFGQEQP 207 DD TF +E+P Sbjct: 1386 DDETFERERP 1395