BLASTX nr result
ID: Zingiber25_contig00029693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029693 (385 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78131.1| hypothetical protein VITISV_000332 [Vitis vinifera] 55 7e-06 ref|XP_002284698.1| PREDICTED: uncharacterized protein LOC100260... 55 1e-05 >emb|CAN78131.1| hypothetical protein VITISV_000332 [Vitis vinifera] Length = 326 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 5/80 (6%) Frame = -2 Query: 384 IEALFRFRVAAA-----RPCQAQVVWEALVIIYMRSLLLVLDTIIACVFINECSSGCSSF 220 +EALF++RV A +P ++ + E L I YM S+L+VLDTI++C+F C GC Sbjct: 239 VEALFQYRVVRAYHISGKP-RSSIALEGLFIAYMYSJLVVLDTIVSCIFFKRCKRGC--- 294 Query: 219 WSKDGGPFSCAVDRMESEDK 160 W+ G S ++ E K Sbjct: 295 WTDQDGTHSYRIEIAEEGGK 314 >ref|XP_002284698.1| PREDICTED: uncharacterized protein LOC100260477 [Vitis vinifera] Length = 326 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/80 (37%), Positives = 45/80 (56%), Gaps = 5/80 (6%) Frame = -2 Query: 384 IEALFRFRVAAA-----RPCQAQVVWEALVIIYMRSLLLVLDTIIACVFINECSSGCSSF 220 +EALF++RV A +P ++ + E L I YM S+L+VLDTI++C+F C GC Sbjct: 239 VEALFQYRVVRAYHISGKP-RSSIALEGLFIAYMYSILVVLDTIVSCIFFKRCKRGC--- 294 Query: 219 WSKDGGPFSCAVDRMESEDK 160 W+ G S ++ E K Sbjct: 295 WTDQDGTHSYRIEIAEEGGK 314